KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_65073Help
Entry
VOLCADRAFT_65073  CDS       T01330                                 

Definition
target of rapamycin, growth-regulatory PI3K-like protein kinase
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
vcn  Volvox carteri f. nagariensis
Brite
Protein kinases [BR:vcn01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   VOLCADRAFT_65073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2426 aa AA seqDB search
MLSGVGPATAKPVFKAADTLSRHLEELCRPGAWERRAKDGDKGLLEYVEAEARDLSLEAF
GRLMSDLYTRIASMLFKGNDITRRMGGVLAIDELTDVKLSGDDAAKTSRLASMLSRVLED
SEDATLSETAAHTLGHLVRSGGAMTSDIVEKEIRRALSWCDPHVEPSESRRLTALLVLHE
AAESAPAVFNVHVKSFIDAVWFPLRDPKQHIREAAVRALKACLCLVEKRETRYRVQWYYK
LFEQTMRGMKRDHRTGSMPSAESIHGSLLALAELLQHTGEFMLARYKEVVENVFRYKDSK
EKNIRRAVIHLLPRMAAFSPERFASEYLSRAIAFLLTVLKNPPERGAAFAALADMAAALA
RPIYAAIREALSVPPAARAAARPRPATCPEALQCVGMLAVALGPLCRPYAAALIESMVLT
GISEVLVSSLTQVANALPELLEDIQYQLLDLLSLVLSKRPFNSATTQPKFAALSAAIAAG
ELQGNALIKLALQTLGTFDLGGIQLLEFMRDHILAYTEDPDKEIRQAAVLAACRVLERHA
ATALSAAAVGAGGRAVQQLASQQGVSVERCVNRLLVVAVADSSERVRKEVLLALVATTAL
DDYLAQADCLRALFVGMNDESCTVRALAIRLVGRLADRNPAHVNPALRKHLLQLLHDMEF
SPDNRAREESAYLLEVLITSAAKLIMPYVSPIQKALVGKLRGIGPSILPTALGTVLSTLG
ALAEVSGTNFRPFISEVVPLVIEAIQDNSDARRRVVAVKTLGFIVSSCGNVMGPYLEYPQ
LLSVLLRMLHEGHAAQRREVIKVLGIIGALDPHTHKVNQASLSGEGKLEKEGVRPLRHGA
GAAAAGGGGGGLDYYPTVAINALMRVLRDPALASQHLAVIRALLSIFKALQLNVVPYLPK
VLPILFGVLRGGDEALREEILGALRALVGYVRQHMRRFLPELLQLIHEFWPTSPRTCLAL
IADLGVALRDDIRWYVPELLPKFVAVFGEAERSGSWDLVRPALGALEALGSAVDDSLHLL
LPSMVRLISPSASSTPAEIRRAALRSMRKLIPRMQLGGYASAVLHPLIKVLDSQSDEQLR
RDAIDTICAVAVCLGPDFAIFVPTIRKVRGGVASESDRRACGRFVDPSVHVCMCTEPPPV
HSFPSCRVRPPDLPAAQIAPRVLSVNAGVLRRAWESSHRVTKEDWAEWMRNFSVELLKES
PSPALRACYGLAQVHPTMARELFAAGFVSCWADLDPALQEQLVRSLEAALASPTIPPETV
TALLNLAEFMEHDDKRLPLDTRTLGALAEKCHAFAKALHYKELEFQTSPQTAIEALIHIN
NQLRQPEAAVGVLTYAQKHLHMELKESWYEKLCRWDEALDAYERRLQREAPGSIEYHTAL
LGKMRCLANLAEWENLSNLCRTEWRKSEPHVRREMAMIAAHAAWHMGAWEEMSSYVDTID
NPDVGPQSQTGTGAFLRAVLCVRSNQFESAKVHVDRARELMVTDLAALVGESYERAYTDM
VRVQQLAELEEVVAYKQALERRAAGSDSRISFIQQLWRDRLRGVQRHVEVWQSLFSIRSL
VVPMAQDVDNWLKFASLCRKSGRQRQAYRMLLQLLRYNPMSINQRGQPGYGAGSGAPHVM
LAFLKHLWTQGQRTEACNRLQDLAPAVAPTASATAPGGGSRWLDRPQASLNGRAFLRLGM
WQWAMNDKLDNPAVIKENLESFRSATEHAPNWAKAWHQWALFNVAVSVHYSTRDETLAVG
HVPPAVQGFFRSVALGQAAGDRTGNLQDILRLLTLWFNHGAYEEVRAALQEGFQLVSIDT
WLLVIPQIIARIHTHNTDVRQLIHHLLVKIGRHHPQALMYPLLVATKSQSPARRQAAYSV
LECIRQHSAALVEQAQLVSGELIRIAILWHEMWHEGLEEASRLYFGESNVEGMLNTLLPL
HEMLEKAGPTTLKEIAFVQSYGRELSEAYEWLMKYKASRKEAELHQAWDLYYHVFKRINK
QLHSLTTLELQYVSPALVRAQGLELAVPGTYIAGEPLVTIAAFAPQLHVISSKQRPRKLT
IHGGDGSEYMFLLKGHEDLRQDERVMQLFGLVNTMLAHDRITAERDLSIARYAVIPLSPN
SGLIGWVPNCDTLHALIREYREARKIPLNWEHRLMLGMAPDYDHLTVIQKVEVFEFALDS
TSGEDLHKVLWLKSRNSEVWLDRRTNYTRSAAVMSMVGYILGLGDRHPSNLMLDRYSGKL
LHIDFGDCFEASMNREKFPEKVPFRLTRMMIKAMEVSGIEGNFRTTCENVMRVLRSNKES
VTAMLEAFVHDPLINWRLLNTTEAATEAALARTGDTATEAAVRGSTSTSLTFMPSPPRRE
TREKELKDAVAQLGDANEVLNTRAVEVMKRMSDKLMGRDYAPEVSVGGGAGGVEPDSVAA
QVQRLIHQAVNHENLCQSYIGWCPFW
NT seq 7281 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaggtgttggcccggctacggctaaaccagttttcaaggctgccgacacgctc
tctcggcaccttgaggagttatgccgccctggtgcatgggagcgccgtgcaaaggatggg
gataaaggcctcttggagtatgttgaggcggaggcacgggacctttctttagaggctttc
ggacggctgatgtccgacctctacactcgcatcgccagcatgctgtttaaggggaacgac
atcacccgtcgtatgggtggcgtgcttgcgattgatgagctcactgatgtcaagctctcg
ggtgatgacgcggccaagacgtcccggctggccagcatgttgtcccgcgtgcttgaggac
agcgaagatgccacactcagtgaaacagcggcacacacgctggggcacttggtgcggagc
ggtggggccatgacgtcggatatcgtggagaaggaaatccgccgcgctctgtcctggtgc
gacccccacgtggagccctccgagtcccggcgcctcaccgcactgctggtgctgcacgag
gcggcggagtcggcccccgcggtgttcaacgtgcacgtcaagagcttcatcgatgcagtg
tggttcccccttcgggaccccaagcaacacatacgggaggcggcggtgcgggctctcaag
gcttgcctgtgtctggttgagaagcgtgagactcgctaccgtgttcagtggtactacaag
cttttcgagcagaccatgcgcggcatgaagcgggaccaccgcacgggctccatgccctcg
gcggaatccatccacggatctctgttggcgctggcggagctgctgcaacacaccggggag
ttcatgctggcgaggtacaaggaggtggtcgagaacgtgttccgttacaaggacagcaag
gagaagaacatccgccgggccgtcatccacctgctgccccgcatggcggccttctcaccg
gagaggtttgcatcagagtacctatctcgcgccattgcgttcctgctgacggtgcttaag
aatcctccggagcggggggcggcctttgcagcgctggcggatatggcagcggcactggcc
cgacccatctatgcagccatccgggaggcgctgtccgtgccccctgccgcccgtgctgct
gcgcggccccgtcccgccacctgccccgaggcgctccagtgtgtgggcatgttggcagtt
gcgctgggcccgctgtgtcggccgtacgcggctgcactgattgaatccatggtgctgacg
ggcatcagcgaggtgctggtgtcctcactgacacaggtggccaatgcgcttcccgagctg
cttgaggacatccagtaccagctgctggacctgctgagtctggtgctctccaagaggccc
ttcaacagcgcgacaacgcagcccaagttcgctgccctcagtgcggctatcgcggcgggg
gagctgcagggcaacgcccttatcaagctggcgttgcaaaccctaggcaccttcgacctg
ggcggcatacagctgctggagttcatgcgcgaccacatcctggcctacaccgaggacccg
gacaaggaaatccgccaggcggcagtgctggcggcgtgcagggtgctggagcgccacgcc
gcgacagctctgtcggccgccgcggtgggggccggcgggcgggcggtgcagcagcttgcc
agccagcaaggtgtgtcggttgagcggtgtgtgaaccggctgctggtggtggccgttgcg
gactcctcggagcgagtccgcaaggaggtgcttctggcgctggtggccaccacggcgctg
gatgactacttggcgcaggcggactgccttcgggctctgtttgttggcatgaacgacgag
agctgcacggttcgcgcactggccatccgcctggtgggtcgtctggcggaccgcaacccc
gcacatgtcaacccggcgctgcggaaacacctgctgcagctgctgcacgacatggagttc
agcccagacaaccgggccagggaggagagcgcctacctgctcgaggtgttgattaccagc
gcagccaagctcatcatgccgtacgtctcgcccatccaaaaggctctggtgggtaagcta
cgtggcatcggtcccagcattctgcccaccgccctcgggacggtgctgtccacgctgggt
gcgcttgcggaggttagcggcaccaacttccggcccttcatcagcgaggtggtgccgctg
gtcattgaggcaatacaggacaactctgacgcccggcggcgggtggtggcagtcaagacc
ttgggcttcattgtgtccagttgcggaaatgtgatgggtccctacctagagtacccgcag
ctgctgtcggtgctgctgaggatgctgcacgagggacatgccgcacagaggagggaggtc
atcaaggtcctgggcatcatcggcgcactggatccgcacacgcacaaggtcaaccaggcc
agtctgagcggggagggcaaactggagaaggagggcgtgcggccgctgcgacatggcgcc
ggggcggcagccgcgggtggcggcggggggggcctggactactaccccacagtggccatc
aacgcgctcatgcgggtactgcgggacccggcactggcctcacaacacctggcggtcata
cgggcgctgctctccatcttcaaggcgttgcaactcaatgtggtgccgtacctgcctaag
gtgctacccatcctgtttggtgttcttcgcggcggtgacgaggctcttcgtgaggagatc
ctgggcgctctgcgggcgctggtggggtacgtgcggcagcacatgcgccgcttcctgccg
gagctgctgcagctgatccatgagttttggccgacctcacctcgcacctgcctggcgctg
attgcggacttgggggttgcactgcgggatgacatacggtggtatgttcctgagctgctt
cccaagtttgttgcggtatttggcgaggcggagcggtctggcagctgggacctggtgcgt
ccggcgctgggggctctggaggcgctgggctccgcggtggacgactctctgcacctgctg
ctgccctccatggtgcgactgatcagcccctcggccagctccactccggcggagatacgg
agggcggcgctgaggtccatgcgcaagcttattccacgaatgcagctgggaggctacgca
tcagctgtgctacacccgctgatcaaggtgctggatagccagagcgatgagcaacttcgg
cgggacgcaatcgataccatttgtgctgtggcggtgtgtctaggaccagatttcgccatc
ttcgtgccaacgattcgcaaggtgcgtggaggcgtggcatctgagtctgataggagggcg
tgtgggcgttttgttgacccatctgtgcatgtctgcatgtgtactgaacctcctccggtg
cattcctttccttcctgtcgggtgcggcctccagatctgccagcggcacagattgcacca
cgagtgctctccgtcaacgcgggggtacttcgccgcgcgtgggagagcagtcaccgggtg
acgaaggaggactgggcggagtggatgcggaacttcagtgtggagctgctcaaggagagc
ccctcgcccgcgttgagggcatgctacgggctagcacaagtccaccccaccatggctcgt
gagcttttcgccgctggctttgtgagctgctgggcggacctggaccctgcactgcaggaa
cagctcgtgcgcagcttggaggccgcgctggcgtcccccaccattccccccgagaccgtg
acggcgttgctcaaccttgctgagttcatggagcacgatgacaagcggctgcccctggac
acccgcacactgggggcgctggcggagaagtgccatgcgttcgccaaggcgctgcactat
aaggagttggagtttcagaccagtccccagaccgccattgaggcgctcatccacatcaac
aaccagctgcgacagcccgaggcagctgtgggtgtgcttacgtatgctcagaagcacctg
cacatggagctcaaggagagctggtacgagaagttgtgccggtgggatgaggcgctggat
gcgtacgagcgccgcctgcagcgggaggcccctggcagcatcgagtaccacacggccctc
ctaggcaagatgcgatgtctggccaacttggcggagtgggagaacctgtccaatctgtgt
cgtacggaatggcgcaaatcggagccgcatgtgcgccgggagatggccatgattgccgca
catgccgcctggcacatgggcgcctgggaggagatgtcgtcgtatgtggacaccatcgac
aaccctgatgtgggcccgcagagccagaccggcactggggcctttttgcgagctgtgctg
tgcgtgaggagcaaccagttcgaatccgccaaggtgcacgtggaccgcgctcgcgagctg
atggtgactgaccttgccgcgctggtgggtgagagctacgagcgggcctacacggacatg
gtgcgggtgcagcagctggcggagctggaggaggtggtggcgtacaagcaggcgctggag
cggcgagcggcgggctccgactcccgcatcagcttcatccagcagctgtggcgagaccgg
ctgcggggggttcagcgacacgtggaggtctggcagagcctcttctccattcgcagcttg
gtggtgcccatggcgcaggacgtggacaactggctcaagtttgcgagcctctgtcgtaag
agcggacggcagcggcaagcctaccgcatgctgctgcagctgctccgctacaaccccatg
tccatcaaccagcggggccagccggggtacggcgccggtagcggggctccccacgtgatg
ttggccttcctcaagcacctgtggacgcagggccagaggacggaggcgtgcaaccgatta
caggacctggcccctgctgtcgcgcccactgcctccgccaccgcacccggtggaggttct
cgctggttggaccggccccaggcgtccctcaacggccgggctttcctccgactgggcatg
tggcagtgggccatgaacgataagctggacaatcccgcggtcatcaaggagaacctggaa
tcgttccgctccgcgaccgagcacgcacccaactgggccaaggcgtggcaccagtgggcg
ctgttcaacgtggccgtatcggtgcactacagcacgcgggacgagacactagcggtgggg
catgtgccgcccgctgtgcagggcttcttccggagtgtggcgctgggtcaggctgcggga
gaccgcaccggtaacctgcaggacattctccgtttgctgactctgtggttcaaccacggg
gcctatgaggaggtccgagcggccctccaggagggcttccagctggtgtccatcgacacc
tggctgctggtcattccgcaaatcattgcgcggatccacacgcacaatacggacgtgcgg
cagctcattcaccacctgctggtcaagattggtcggcatcacccgcaggcgctcatgtac
ccactgctggtggcgaccaagtctcagagccccgctcggcgccaggcagcctactccgtg
ctggagtgcattcggcagcacagcgcagcgctggtggagcaggcgcagctggtcagtggg
gagctcattcggatagccatattgtggcatgagatgtggcacgaaggtcttgaggaggcc
agtcggctgtatttcggagagagcaacgtagagggcatgctcaacacattgctgcccctg
cacgaaatgcttgaaaaggcggggcccacaacactcaaggagattgcatttgtgcagtcg
tacggaagagagctgtccgaggcttacgagtggctgatgaagtacaaggccagtcggaag
gaggcggagctgcaccaggcctgggacctatactaccacgtcttcaagcgcatcaacaag
cagctccactctctcaccacgctggagctgcagtacgtcagtccggcgctcgtgcgcgcg
cagggactggagctggcggtgccgggcacgtacatcgccggcgagccgctggtcaccatt
gcagcgtttgcgccgcagctgcacgttatctcgtccaagcagcggccccggaagctcacc
atccacggtggcgacggctcggaatacatgttcctgctcaagggtcacgaggacctgcgt
caggacgagcgtgtgatgcagctgttcggtttggtgaacaccatgttggctcacgaccgc
atcactgcggagagggacttgtccattgcgcgttacgccgtcatcccgctcagccccaac
agcggcctcattggttgggtgcccaactgcgacaccctgcacgccctcattcgggagtac
agggaggctcgcaagattccgctcaactgggagcaccggctgatgctgggcatggcacct
gactacgatcacctgacggtcattcagaaggttgaggtgtttgagtttgcattggactca
accagcggagaggacctgcacaaggtcttgtggctcaagagccggaacagcgaggtgtgg
cttgaccgccgtaccaactacactcgctctgcggccgtgatgtccatggtgggctacatc
ctggggctgggtgaccgccacccctccaacctcatgttggacaggtacagcggcaagctg
ctgcacatcgatttcggggactgcttcgaggcgtccatgaaccgtgagaagttccctgag
aaggtgcccttccggctgacccgcatgatgatcaaggcaatggaggttagcggcattgag
ggcaacttccgaaccacgtgcgagaatgtgatgcgggtgctgcgttccaataaggagtcc
gttacggccatgttggaggcctttgtgcacgacccgctcattaattggcgcctgctaaac
accacggaggcggccacggaggcggcactggcgcgaaccggagacacggccacagaagcg
gcggtgaggggtagcacctccacaagccttaccttcatgcccagcccccctcgccgggag
acccgcgagaaggagctcaaggatgctgtggcgcagctgggggatgccaacgaggtcctc
aacacgcgtgccgtagaggtgatgaagcgtatgtctgacaagcttatggggcgggactat
gcaccggaggtttcagtgggtggaggtgctggcggcgtggagccagacagtgtggcggcg
caggtacagcggcttatccaccaggccgtcaaccatgaaaacctgtgccagtcgtacatt
ggttggtgcccgttttggtag

DBGET integrated database retrieval system