KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_65082Help
Entry
VOLCADRAFT_65082  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K12657  delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00330  Arginine and proline metabolism
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01230  Biosynthesis of amino acids
Module
vcn_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VOLCADRAFT_65082
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     VOLCADRAFT_65082
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     VOLCADRAFT_65082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 9625062
NCBI-ProteinID: XP_002954612
JGI: 65082
UniProt: D8U7K7
Position
Unknown
AA seq 337 aa AA seqDB search
GVLLVIFEARPDALPQIASLALRSGNGLLLKGGKEATHSNAALHKVIVDAIGPSLGPDLI
ALVTSREEIESLLALDDVVDLVIPRGSNALVSHIKRNTRIPVLGHADGICHVYVDEEADL
DTALRILLDAKTDYPAACNAVEKVLVHRSWADKGGLQTITEALQKAGVKVHVGDLKSSLP
DLPAAPAARHEYSALAVTLEVVDSMEAAIDHIHKYGSAHTDCIVTKNGERAEAFLRGVDS
ACVFHNASTRFADGFRFGLGAEVGISTSRIHARGPVGVEGLLTTKWVLRGGGHIVAKDTG
VKFTHRPLSSDDSARGEAEPQQGGRRRQDGGGRCAVM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ggggtgctgctggtcatattcgaggcgcggcctgacgcgctgccacagattgcctccctg
gcgctcaggtccggaaacggcctgctgctcaagggaggcaaggaggcgacccactccaat
gccgccctgcacaaggtgattgtggacgccatagggccctccctgggccccgatctgatc
gcgctggtgacgagccgggaggagatcgagagcctgctggcgctggatgacgtggtggac
ctggtcatcccgcgcggctccaacgcgctggtatcccacatcaagcgcaacacgcgcatt
cccgtactgggtcacgctgacggcatctgccacgtgtatgtggacgaggaggctgacctg
gacacggccctgcgcatcctgctggacgccaagaccgactacccggctgcctgcaatgcg
gtggagaaggtgcttgtgcacaggagctgggcggacaagggggggctgcagaccattaca
gaggctcttcagaaggccggtgtcaaggtgcacgtcggtgatctaaagagctcgctacca
gatctacccgcggcgcccgcggcccggcacgagtacagcgccttggccgtgaccttggag
gtggtggacagcatggaggctgccatcgaccacatacacaagtacggcagtgcgcacacg
gattgcatcgtgaccaagaacggcgagcgagcggaggctttcctgcgcggtgtggacagc
gcgtgcgtcttccacaatgcctcgactcgctttgcggacggcttccgcttcggactggga
gccgaggtcgggatcagcaccagccgcatccacgcgcgcggaccggtgggggtggagggt
ctcctcaccaccaagtgggtgctgcggggtggcggtcacatcgtggccaaggacaccgga
gtgaagttcacacacaggccgctgagctcagacgacagcgcgcggggggaggcggagccg
cagcaaggcggcaggcggcgccaagatggcggaggccgctgtgcagtgatgtaa

DBGET integrated database retrieval system