KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_66296Help
Entry
VOLCADRAFT_66296  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vcn00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vcn00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:vcn00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 483 aa AA seqDB search
MTSHKGFQLVVAATPSLGIGKNGTLPGWKLPGDMAYFRELTSRTREPSCQNVAIMGRKTW
ESIPNKFRPLKGRINIIARRNGAQFGPDVLGCSSLGAALELLEDEKLKRDVDFVFVIGGA
QVYAEALRHPSCTAVHLTKVEKEFDCDAHLPPLDPSVFGVWSASEPFQENDTRYSFVCYT
RRGLSPPPELPPGMASRHDEIQYLELVRELITSGTFRPDRTGTGTYSRFGRTARYNLRHT
FPLLTSKRVFWKGVAEELLWFIRGSTNANLLRDKNIHIWDGNSTREYLDSRGLHHREVGD
LGPVYGFQWRHFGAAYKDMHTDYTGQGVDQLKAIIEQIRKDPNDRRMIMSAWNPAALNEM
ALPPCHMFCQFYVADGELSCLMYQRSCDVGLGVPFNIASYALLTRLVAQVTGLRAGDFIH
VMGDTHVYANHVEPLKEQLKNTPRHFPILNINPAKTDIDSFVFEDFELVDYQPHQTIKMK
MAV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacaagccacaagggatttcaacttgtcgtcgccgcgacgcccagcctgggcattggc
aagaacggtactttacctggatggaagctgccaggcgacatggcctactttcgtgagctg
acttcgcgaacccgcgaaccgtcctgccagaacgtagccattatggggcgcaaaacctgg
gaatccatccctaataaattccggccgcttaagggtcgcatcaacatcatagcgcggcgc
aacggcgcacaattcggccctgatgttttgggttgcagcagcctgggtgcggctctggag
ctgctggaggatgaaaagctaaagcgagatgtcgatttcgtgttcgtcatcggcggggcc
caagtttacgcggaggccttgcgccaccccagctgcactgccgtgcacctaacgaaggtg
gagaaggagttcgactgcgacgcacatctaccgccgctggacccctcggtgtttggcgtg
tggtcagccagtgagcctttccaggagaatgacacaaggtactcgtttgtgtgctacacg
cggcggggtctgtcgccaccgcctgagctgccaccggggatggcgtcgcggcatgatgag
atccagtacctggagctcgtccgcgagcttatcacgagcggcaccttccggcccgacagg
acgggcactggcacctactcgcgcttcggccgcactgcccgctacaaccttcgacacacc
ttccctctgctgacatccaagcgagtcttctggaagggtgtggccgaggagctgctctgg
ttcatccgcggctccaccaatgccaacctgctgcgtgacaagaacatccacatctgggac
ggcaacagcacccgcgagtatctggacagccgtgggctgcatcaccgggaggttggcgac
ctaggacccgtgtacggctttcagtggcgacacttcggcgcggcgtacaaggacatgcac
accgattacacgggtcagggtgtcgaccagctaaaggccatcatcgagcagattcgcaag
gatcccaacgaccgccgcatgatcatgtcggcttggaatcccgcggcattgaacgagatg
gcgctgcctccgtgtcacatgttctgtcagttctatgtggcggacggagagctcagctgc
ctcatgtaccaacgcagctgcgacgtggggctgggagtgcccttcaacatcgcatcctac
gctctgctcacccgcctcgtggcgcaggtcacggggctgcgcgccggggacttcattcat
gtgatgggcgacacgcatgtgtacgccaaccacgtggagccgctcaaggagcagctcaag
aacacgccccggcatttcccgatcctaaatataaatcccgccaagacggacatcgactcc
ttcgtgtttgaggacttcgagttagtcgactaccaaccgcaccagaccatcaagatgaag
atggcggtatga

DBGET integrated database retrieval system