KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_66436Help
Entry
VOLCADRAFT_66436  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    VOLCADRAFT_66436
Protein phosphatases and associated proteins [BR:vcn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     VOLCADRAFT_66436
Ubiquitin system [BR:vcn04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     VOLCADRAFT_66436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 340 aa AA seqDB search
MAESRTALLQLLAPLMEGVRHLAAYRCSEALAALSRLPMSQARTAWVMGAMGRAHFESMN
YAKAAQVRFESARQLDRTRVEGMEIYSTVLWHTKREYELSHLAQECVATDRLAPQTWCVL
GNLFSSQKEHEAAIEFFLRAAQVDPTFTYAYTLAGHEYFANEDYDKAAACYRSALKLDPR
HYKAMYGLGQIAYRQEKYAEALQNFRLAAGINPRSSVLRCYVGMSAAKLGQTPLALEKLQ
EAIDLDPANPLARFERASVLASLERIGEALAELEALQRMAPGEASVAFQMGKLFKRLNNR
TVSKSTYVHVCFGGRTSKSVKVLLSTLSTLLGVEQFPNCL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcagagagccgcaccgccttgctgcagctgctggcgccgctgatggagggcgtgcgg
cacctggcggcgtatcgctgctcagaggcgctggccgcgcttagccggctacccatgtcg
caggctcgcacagcctgggttatgggcgcaatggggcgggcgcactttgagagcatgaac
tacgccaaggcagcgcaggtgcgctttgagagcgcacggcaattggaccgcacccgagta
gagggcatggagatctacagcaccgtgttatggcacaccaagcgcgagtacgaactgagc
cacctggcgcaggaatgcgttgcgacagacagattggcgccacagacgtggtgtgtgttg
gggaacctgttcagcagccagaaggagcacgaggcggccatcgagttctttctgcgcgcg
gcgcaggttgaccctacgttcacgtacgcctacacgctggcggggcacgagtactttgcc
aatgaggactacgacaaggcagccgcctgctaccgctccgcactgaaactggatcccagg
cattacaaagccatgtacggcctgggccaaatcgcatatcggcaggaaaaatacgccgag
gcgctccagaacttccgtctggctgcgggcatcaacccgcggtcctcggtgttgcgctgc
tacgtgggaatgagtgcagccaagctgggacagacgccactggctctggagaagctgcag
gaggccattgatttggatccggccaaccctctggcgcgatttgagcgggcctctgtgctg
gcttctttggagcgaattggggaggctctcgctgagctggaggcgcttcagcggatggct
ccaggggaagccagtgtcgccttccagatgggaaagctatttaagcgcctcaacaaccgc
acggtaagcaagagcacgtacgttcatgtgtgttttggtggccgaacgagcaagagcgtc
aaggtcctcctctcaacactgagcactcttctcggagttgaacagtttcccaactgcctt
taa

DBGET integrated database retrieval system