KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_66749Help
Entry
VOLCADRAFT_66749  CDS       T01330                                 

Definition
mitochondrial pyruvate dehydrogenase kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     VOLCADRAFT_66749
Protein kinases [BR:vcn01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   VOLCADRAFT_66749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 400 aa AA seqDB search
MGPAAAPAILSGFGLAVRGFARAAAVASRQAAVSVRLIDSFNKELVDDIFAHALKKQTGV
SLKYMLDFGQNPIERQMLLSAQFLHKELPVRLAHRVAELENLPYGLSAKKPILQVRDWYV
ESFRDLRSFPPVKDNSDELKFTEMLRHVYRRHANAVPVMAKGVGELREELRARQQLTELP
EIHQFLDGFYLSRIGIRILIGQHIALHEPSKPNHIGLICTRCSPVLVAQDAINDARSICM
REYGDAPEVSVYGSPDFTFPYVPSHLHHMLFELVKNSLRAVQDRFAESDDPAPPIRLVVA
EGGEDVTLKVSDEGGGIPRSGLANIWTYLYSTAKSPVDPRAVDDADSGPVVLAGYGYGLP
ISRLYARYFGGDLQIISMEGYGTDAYLHLNRLGTSQEPLP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggggcctgcggcagcccccgcaattctctctggcttcgggttagcagtaagagggttt
gcgcgggctgccgccgttgcgtcgcgtcaagctgctgtcagcgtgcgtctcatcgattcg
ttcaacaaggagctggtcgacgacatctttgcgcacgcgcttaagaagcaaaccggcgtt
agcctcaagtatatgttggactttgggcaaaaccctatcgagcggcaaatgctcctttcg
gcgcaattcttgcacaaggagctacccgtgcgcctcgcacaccgtgttgcagagctggaa
aacttgccttacgggctctctgcgaagaagcccatcctccaggtccgtgactggtacgtt
gagtccttccgggacctcagatccttcccgccggtgaaggacaattcggacgagctcaag
ttcacggagatgctccgacatgtgtaccgccgtcacgccaacgcggtgccggtgatggca
aagggtgttggcgagctgcgcgaggagctgcgggcccgacaacagctcacagagctcccg
gaaatccaccagttcctggacggattctaccttagccgcattggcatccgcattcttatc
ggtcagcacatcgccctccacgagccctccaagcccaaccacatcggcctcatctgcacc
aggtgctcgcccgtactggtggcgcaggacgcgatcaacgacgccaggtccatctgcatg
cgggagtacggggacgccccggaggtatccgtgtacggcagtccggacttcacgtttccg
tacgttccatcgcaccttcaccacatgttgttcgagctggtgaagaacagcttgagggcc
gtacaggataggttcgcggagagcgatgatccagcaccgcccatcaggctggtggtagcg
gaaggtggagaagatgtgacactcaaagtgagtgacgagggcggcggcatcccccgcagc
ggtttggccaacatctggacctatctgtactccaccgcgaagagtcctgtggatccccgc
gctgtggatgacgcggacagcgggccggtggttttggcgggttacggctacggactaccc
atcagtcgcctgtacgcccggtacttcggaggggatctgcagatcatctccatggagggg
tacggcacggatgcctacctgcacctgaaccgcctgggcaccagccaggagccgctgccg
taa

DBGET integrated database retrieval system