KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_66749Help
Entry
VOLCADRAFT_66749  CDS       T01330                                 

Definition
(RefSeq) mitochondrial pyruvate dehydrogenase kinase
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     VOLCADRAFT_66749
Protein kinases [BR:vcn01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   VOLCADRAFT_66749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3 DUF677
Motif
Other DBs
NCBI-GeneID: 9618955
NCBI-ProteinID: XP_002956155
JGI: 66749
UniProt: D8UBX0
Position
Unknown
AA seq 400 aa AA seqDB search
MGPAAAPAILSGFGLAVRGFARAAAVASRQAAVSVRLIDSFNKELVDDIFAHALKKQTGV
SLKYMLDFGQNPIERQMLLSAQFLHKELPVRLAHRVAELENLPYGLSAKKPILQVRDWYV
ESFRDLRSFPPVKDNSDELKFTEMLRHVYRRHANAVPVMAKGVGELREELRARQQLTELP
EIHQFLDGFYLSRIGIRILIGQHIALHEPSKPNHIGLICTRCSPVLVAQDAINDARSICM
REYGDAPEVSVYGSPDFTFPYVPSHLHHMLFELVKNSLRAVQDRFAESDDPAPPIRLVVA
EGGEDVTLKVSDEGGGIPRSGLANIWTYLYSTAKSPVDPRAVDDADSGPVVLAGYGYGLP
ISRLYARYFGGDLQIISMEGYGTDAYLHLNRLGTSQEPLP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggggcctgcggcagcccccgcaattctctctggcttcgggttagcagtaagagggttt
gcgcgggctgccgccgttgcgtcgcgtcaagctgctgtcagcgtgcgtctcatcgattcg
ttcaacaaggagctggtcgacgacatctttgcgcacgcgcttaagaagcaaaccggcgtt
agcctcaagtatatgttggactttgggcaaaaccctatcgagcggcaaatgctcctttcg
gcgcaattcttgcacaaggagctacccgtgcgcctcgcacaccgtgttgcagagctggaa
aacttgccttacgggctctctgcgaagaagcccatcctccaggtccgtgactggtacgtt
gagtccttccgggacctcagatccttcccgccggtgaaggacaattcggacgagctcaag
ttcacggagatgctccgacatgtgtaccgccgtcacgccaacgcggtgccggtgatggca
aagggtgttggcgagctgcgcgaggagctgcgggcccgacaacagctcacagagctcccg
gaaatccaccagttcctggacggattctaccttagccgcattggcatccgcattcttatc
ggtcagcacatcgccctccacgagccctccaagcccaaccacatcggcctcatctgcacc
aggtgctcgcccgtactggtggcgcaggacgcgatcaacgacgccaggtccatctgcatg
cgggagtacggggacgccccggaggtatccgtgtacggcagtccggacttcacgtttccg
tacgttccatcgcaccttcaccacatgttgttcgagctggtgaagaacagcttgagggcc
gtacaggataggttcgcggagagcgatgatccagcaccgcccatcaggctggtggtagcg
gaaggtggagaagatgtgacactcaaagtgagtgacgagggcggcggcatcccccgcagc
ggtttggccaacatctggacctatctgtactccaccgcgaagagtcctgtggatccccgc
gctgtggatgacgcggacagcgggccggtggttttggcgggttacggctacggactaccc
atcagtcgcctgtacgcccggtacttcggaggggatctgcagatcatctccatggagggg
tacggcacggatgcctacctgcacctgaaccgcctgggcaccagccaggagccgctgccg
taa

DBGET integrated database retrieval system