KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_67026Help
Entry
VOLCADRAFT_67026  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
vcn  Volvox carteri f. nagariensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 351 aa AA seqDB search
MSWRPQVFIHSPLMRNYFLGQGHSQSACLRHGKSPGVPCLSCELDAVFAAAYSGDRAPLS
PTDFLYSWWTFADSLAGYRQQDAHEFYLSALSGLAGVQPNTGVGSCRGRGLVPLVDAVFG
GVLRSDVTCSVCGHTSTAYDPFLDISLDMVQGHGAGFGAANPSVPRCAQGAVGHATLQGC
LRHFVTPERLSAGEAWVCSACKQQQPAVKQLSIRRLPPVLALHVKREEELWPPFRPCPVQ
TKLHFPLSLDLAPYTTPAILRERCGFQRFPCEPALGDLGGLNDTVSCRYRLFAVISHKGD
LSGGHYVVFVRPGGAAGGSWYQCDDAWVTAVSVEDVTACQAYMLFYSDEAS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcggccgcaggtcttcattcactcgccgttgatgaggaactacttcctaggc
caggggcattcgcaaagcgcgtgcctcaggcatggcaagtcgcccggggtcccctgccta
tcctgcgaactggacgcggtgttcgctgccgcctactcgggcgaccgggcgcccctcagc
cccacggacttcctgtactcgtggtggacatttgccgacagcctggcaggctaccggcag
caagacgcgcatgagttttatctgtccgcgctgtcaggtctcgcgggcgtgcagcccaac
acgggggtcggcagctgccgcggccgcggtcttgtcccgctggttgacgccgtgttcggt
ggggtgctgcggagcgatgtgacctgctctgtgtgtggtcacacgtccactgcgtacgac
cctttcctagacatatctttggacatggtgcagggccacggagcaggtttcggagccgca
aacccgtccgtgccccgctgcgcgcagggagcggttggccatgccaccctgcagggctgt
ctgcgccacttcgtcactccggagcggctgtccgcgggggaggcctgggtctgcagcgcc
tgtaagcagcaacagcccgctgtaaagcagctctccatacgccgcctgccgcccgtactg
gcgctacatgtgaagcgagaagaggagctctggcctcccttccgtccctgtcccgtgcag
actaagctccacttccccctctctctggacttggcgccgtacacgacaccagctatcctg
cgtgaaaggtgcggtttccagcgttttccttgcgaacctgctcttggcgatttaggaggt
cttaatgacactgtttcttgccgctaccggctgtttgccgttatcagccacaagggcgac
ctgtcggggggccattacgtggtgttcgtgaggcccggcggggccgcggggggcagctgg
taccagtgcgatgacgcctgggtgacggccgtgagtgtggaggacgtgaccgcctgccag
gcctacatgctgttttacagtgacgaggcctcctaa

DBGET integrated database retrieval system