KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_67197Help
Entry
VOLCADRAFT_67197  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    VOLCADRAFT_67197
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     VOLCADRAFT_67197
Peptidases [BR:vcn01002]
 Metallo Peptidases
  Family M67
   VOLCADRAFT_67197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 212 aa AA seqDB search
MPPPPPTDISSTPAPATGPASGGPKELRKRAQLRDVHVSVALMEEFLAYARSNTSRGIES
CGILAGRLLAGDSTFAITTLIIPKQEGTTDTVTALNEEEVFEAQFSRELYPLGWIHTHPT
QTCFLSSVDVHTQCGYQTMLDEAVAIVMAPSDVSKKCGIFRLSTPGGLGLVQKCPQRGFH
VHPPTDTGQELYELCSHVFLNPRTHHEVLDLR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgccgccgccaacggacatctcttccacacctgctcctgccactggccccgca
tccggaggccctaaggagcttcgaaagcgcgcgcagctgcgtgacgtccacgtcagcgtc
gccctcatggaggagttcctggcttacgcacggtccaacacgtcccgtggtatcgagtcg
tgcggcatcttggcggggaggttgttggcgggggactctacgtttgccatcaccacgctc
atcatccctaagcaggagggcaccacggatacggtgacggcgctgaatgaggaggaggtt
ttcgaggcgcagttctcccgggagctatatcccctggggtggatccacacgcaccccaca
cagacgtgcttcctttcgtcggtagatgtgcacacccagtgcggctatcagaccatgttg
gatgaggctgtggccatcgtcatggcgccgtcggacgtttccaagaagtgcggcatcttc
cgactgagcaccccgggcggactgggtctcgtgcagaagtgcccccagcgcggcttccac
gtgcacccgcccacggacacgggccaggagctgtacgagctgtgtagccacgtgtttctc
aacccgcggacacaccacgaggtcctggatctgcgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system