KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_68392Help
Entry
VOLCADRAFT_68392  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
vcn  Volvox carteri f. nagariensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 364 aa AA seqDB search
MGANSTKLEKALAEAPEDERYYGLENFGNTCYCNSVLQALYFCKPFRERLLKYAATLPSN
TEENLLNCLAELFAQINSSKKKVGVVSPKKFVTRLKRDNEVFRGHMHQDAHEFLNYLLNQ
SCELLEQEARANQKQQQLAGGAGGGGGPGSQQGAPREPITTWVHEIFQGKLVNETRCLHC
ETVTCREEVFMDLSLEIEQNTSLTSCLRNFSSMEMLDRDDKFFCDQCCCLQEAKKRMLLR
SAPPCLILHLKRFKYVEAQGRLRKLMYRVVFPMELKLSNTTADDPGAADTLYTLTAVVVH
LGSGPHHGHYVSLIKSGPQWLSFDDESVLPITESEVQSTFGSTSEYGQNNMDHGYILFYE
RAGG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggggccaactccactaagctagagaaggcgttggccgaggccccagaggatgagcga
tattatggacttgaaaattttggtaacacttgctactgcaactcagtgcttcaagctctg
tatttctgcaagccgttccgagaacgattgttaaaatatgctgcaacgttaccgagtaac
acagaagagaacttgctgaactgccttgcggagctcttcgcccagataaactcgagcaag
aagaaggtgggggtggtgtcgccgaagaagttcgtaacgcgccttaaacgcgacaacgag
gtcttccggggacacatgcaccaggatgctcacgagttcctgaactacctcctcaatcag
agctgtgagctactggagcaggaggcgagagccaaccaaaagcaacagcagctagcagga
ggggcaggaggcggagggggcccgggttctcagcaaggggccccgcgggagcccatcacc
acctgggtacatgagatattccagggcaagctggttaacgagacgcggtgcctgcactgc
gagacggtcacgtgtcgcgaggaggtgtttatggacctcagtctggagattgagcagaac
acgtcgctcacctcgtgcttgaggaactttagctccatggaaatgttggatcgggacgac
aagttcttttgtgaccagtgctgctgcctgcaggaggcgaagaagcgcatgttgctgcgc
tccgccccgccctgcctcatcctgcacctcaagaggttcaaatacgtggaggcgcagggc
aggctccgcaagctgatgtaccgggtcgtgttcccgatggagctcaagttgtccaacacc
acggcggacgacccgggggccgcggacaccctctacacgctgacggcggtggtggtgcac
ctggggagcggcccacaccacggccactacgtgtccctcatcaagagcggcccccagtgg
ctttccttcgacgacgagtccgtactgcccatcacggaaagcgaggtgcagagcacgttc
ggatccacctccgagtacggacaaaacaacatggaccacggctacatactcttctacgag
cgggcgggaggctag

DBGET integrated database retrieval system