KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_70119Help
Entry
VOLCADRAFT_70119  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     VOLCADRAFT_70119
Peptidases [BR:vcn01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   VOLCADRAFT_70119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 252 aa AA seqDB search
GAGYHNLGNTCFMNSVLQALAHTPPLAEFRLGRQEDSHEFLRCLLDAMHEACLKRFKPKP
PPELAATTFVYRIFGGRLRSQIECEGVDYVSRTYDPFLDLSLEINRAQSLERALSAFTAP
EVLDGPNKYRCPKNNKLVRAVKRISVEEAPNVLTVHFKRFEYGGFGAKINKKVDFGTQLD
LRPYMSNVKGPQQLYELYGVLVHHGYSVNSGHYICYVKAANGLWHVCDDHRVTAVGERTV
LDQRAYILFYVR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ggcgccggttaccacaatcttggcaacacatgcttcatgaacagcgtactacaggctctt
gcgcacacgccgcctctggcggagttccggctgggtcgacaggaggatagccacgagttc
ctgcgctgcctgctggatgctatgcacgaggcgtgtctgaagcgtttcaagcccaagccg
cctccggagctcgccgccaccacatttgtgtaccgtatcttcggtggccggctgcgcagc
cagattgaatgcgaaggcgtggattatgtcagtcgcacgtacgaccccttcctagacctt
agcctggagatcaaccgcgcacagtccttggagcgcgccctctctgcgttcacggcaccc
gaggtactggatgggcccaacaagtaccgctgtcccaagaataacaaactggtccgcgca
gtgaagcgaatcagcgtggaggaggcgccaaacgtgctgacggtgcacttcaagcgcttc
gagtacggtggattcggagccaagattaacaagaaggtggattttggaacacagctggat
ctgcgaccgtacatgagcaacgttaaggggccccaacagctgtacgaactgtacggagtg
ctcgtgcatcacggttactcggtcaacagcgggcactacatctgctacgtcaaggcagct
aatggtctctggcacgtatgcgatgaccaccgggttactgcagtgggggagcgcacggtc
ctggaccagcgagcctacatactgttttacgtccgc

DBGET integrated database retrieval system