KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_72683Help
Entry
VOLCADRAFT_72683  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vcn00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 391 aa AA seqDB search
MNQQLRSLGRAPCIGCQRRALVVRNVAEAVRPVVASTNGKARVGVPEGTPIVTPQDLPSR
PRRNRRSETFRSAIRESIVSPANFILPIFVHEEGSNNIPIASMPGIYRLAYGKNVIDYVA
EARSYGVNQVVVFPKTPDHLKTPTAEEAFNPNGLSQRTIRLLKDTFPDLEVYTDVALDPY
NSDGHDGIVSDAGVILNDETIEYLCRQAVSQAEAGADVVSPSDMMDGRVGAIRRALDREG
FTNVSIMSYTAKYASAYYGPFRDALASAPKPGQAHRRIPPNKKTYQMDPANYREAIREAK
ADEAEGADIMMVKPGMPYLDVVRLLRETSPLPVAVYHVSGEYAMLKAAAERGWLNEKDAV
LEAMTSFRRAGADLILTYYGIEASKWLAGEK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcagcttcgcagcttgggccgtgcgccttgcatcggctgccaacgccgtgct
ctggtggttcgcaacgttgcggaggcagtccgtccagtggtggcctcgaccaatggcaag
gcgcgggttggcgtcccagagggtacaccaattgttactccacaggacctaccgtcgcgt
cctcgtcgcaaccgtcggagtgagacgttccgctctgcaattcgcgagagcatcgtatct
cctgccaatttcatcttgccaatttttgtgcacgaggagggcagcaacaacatccctatt
gcgtccatgccgggcatctaccgtcttgcctatggcaagaacgttattgactatgttgcc
gaggcgcgctcctacggcgtgaaccaggttgtggtcttcccgaagactcctgaccatctg
aagacaccaaccgccgaggaggccttcaaccccaacggtctgtcgcaacgcactatccgc
cttctgaaggacactttccctgatttggaggtctacacggatgtggccctggacccgtac
aactcggatggccatgatggcatcgtgtcggacgccggcgtgatcttgaacgatgagacc
attgagtacctgtgccgccaggcagtcagccaggcggaggccggtgccgatgttgtttcc
ccctcggacatgatggacggccgcgtgggcgctattcgccgtgcgctggatcgcgagggc
ttcactaacgtgtccatcatgagctacaccgccaagtacgcgtcagcttactacggcccc
ttccgtgatgccctggcgtccgcaccgaagccaggccaggcgcacaggcgcatcccgcct
aacaagaagacgtaccagatggacccggcgaactatcgggaagctattcgggaggccaag
gccgatgaggccgagggggcggacattatgatggtgaagcccggcatgccatatctggac
gttgtccggttgctcagggagacgagcccgctgccggtggccgtctaccacgtatcggga
gagtacgccatgctcaaggctgcggcggagcgaggttggctgaacgagaaggatgcggtg
ctggaggctatgacgagcttccgccgcgccggcgcagatctcatcctgacttactatggc
atcgaggcgtccaagtggcttgcgggggagaagtaa

DBGET integrated database retrieval system