KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_73333Help
Entry
VOLCADRAFT_73333  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     VOLCADRAFT_73333
Protein kinases [BR:vcn01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   VOLCADRAFT_73333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 415 aa AA seqDB search
MNRKRPEPIAVPEEKKTSYVLTNNGTFVEGDLTISREGLQINSPASTLGAARPGSANSLQ
PNKRPLPQEEDSASSRGPGEASTSGNGAALTSPHTRCGASASSEPLTLDDFEEICVIGQG
SSGVAKKVRNKRDGRLMVLKVIQFDVSSDVIRKQVTTELRTLYGAAHRNVVKYSAAWFDN
GAITIAMEYCDAGSLADLLKRLAGPGLPEPVIAHIARQLVAGLHYLHKELKVVHRDIKPS
NLLLNGKGEVKISDFGVSGQLASSVSNCLSWVGTVTYMSPERIKGDSYSFDSDLWSLGLT
LLECALGRFPYPPPGESTGVNLGFWELLEYIVIEPAPTLPADQFSPELVDFVAQCLQKDA
KARASVTTLAQHPFLKLHPDASLQDVLEPVMVAAGTVAAAAAVAPLPPPPPPQAK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaaagaccagagccgattgctgtccccgaggaaaagaagacgtcctatgtc
ctcacgaacaacggcacgtttgtggagggcgacctaaccataagtcgtgaaggtctgcag
ataaattcaccagcaagcacgcttggggctgcgcgccctggctcggcaaattcattgcag
ccaaacaagcggccactaccacaggaagaggactcggcgagctcgcgggggcctggcgag
gcaagtaccagcggtaatggtgcggcattgaccagcccgcacactcgttgtggagcttca
gcgtcctcggagccgctgaccctggatgactttgaggagatttgcgttatcgggcaagga
agcagcggtgtggcgaagaaggtccgaaacaagcgcgacggccggctcatggtcttgaag
gtcattcagtttgatgtgtcttcagacgtcattcgtaagcaggtcacaacggaattacgc
acgctgtacggtgcagcccaccgcaatgtggtaaagtacagcgcagcctggtttgacaat
ggtgccatcaccattgccatggagtactgcgatgctgggagcctggcagatctgctcaag
cgcctggcgggtccgggattgccggagcccgtcattgcacacattgctcggcagcttgtg
gcggggcttcactacctgcataaggagctcaaggttgtccaccgggacattaaaccctcc
aaccttctgctcaacggcaaaggggaggtcaagatcagtgactttggcgtctcgggacag
ctggcttcctccgtatccaactgcctgtcgtgggttggtacggtgacgtacatgagtcca
gaacgcatcaagggcgactcgtacagcttcgatagcgacctgtggagcctgggccttaca
ttactggagtgcgcattggggcgatttccgtacccaccgcctggtgagtcgactggcgta
aacttagggttctgggagctgctcgagtacattgtcatcgagcccgcgcccacgctgcca
gctgaccagttctcgccagagctggtggatttcgtggcgcaatgcctgcagaaagatgcc
aaggccagggctagcgtcacgaccctagcgcaacaccccttcctcaagctccaccccgac
gcatctctacaggacgttctggagccggtgatggttgccgccgggacggttgctgctgct
gccgcagtggcgccgctgccgccgccgccgccgccacaggcgaaatga

DBGET integrated database retrieval system