KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_73602Help
Entry
VOLCADRAFT_73602  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VOLCADRAFT_73602
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    VOLCADRAFT_73602
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     VOLCADRAFT_73602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 294 aa AA seqDB search
MAYALPLHQHGKSKVRLGRVWRDGNIHHMVEWNVDTMIESDMEHAFVKGENTGMTATDTQ
KNTVYVVAQRMSQKCTVEQFAIALAQHFVRTYPLVSKAKIYVEQKPWNRMQIGGLPHDHG
YALAGTEMRTVYVTYDKAGKLDVTAGLKELSLLKTTQSGYEGFLRDEYTVLPEVNDRIMA
STVTCTWKYTTQPSCYDAAFSAAKSGLLDAFLGPAKSGVYSPSVQYTLYNMAKNLLDRVP
QAESVFLNMPNLHFIPVNPVGSKFNNDVYVATSEPHGNIEAVVTRRGMMPHAKL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgcgttgcctttgcaccaacatggaaagagcaaggtccgccttggtcgcgtc
tggcgcgatggcaatatccaccacatggttgagtggaatgttgacaccatgatcgagtcc
gatatggagcatgccttcgtcaagggcgagaacactggcatgacggcaacggacacccaa
aaaaatacggtatacgtcgtggcgcagcgtatgtcccagaaatgcaccgtggagcagttt
gccatagccctggcacagcacttcgtgcgcacctacccgctggtgagcaaggccaagatt
tacgttgagcagaagccctggaaccgcatgcaaattggtggcctgccgcacgatcatggt
tacgcacttgccggcaccgagatgcggacggtgtatgtcacttatgacaaggctggcaag
ctggacgtaactgctggccttaaggagctgagcctacttaagactacccagtcgggctac
gaaggcttcttgcgcgacgagtacacggtgttgccggaggtcaacgaccgcatcatggcc
tctaccgtgacctgcacttggaagtacaccacccagccatcctgctatgatgccgccttc
tcggctgccaagagcgggctgctagacgcattcctgggcccggccaagagtggcgtgtac
agccctagcgtgcagtacacgctgtacaacatggccaagaacttgctggaccgcgtgccc
caagccgagtcggtgttcctgaacatgcccaacctgcatttcatccctgtcaatccggta
ggctccaaattcaacaacgacgtgtatgtcgccacaagcgagcctcatggcaacatcgag
gccgtagtgacgcgccggggaatgatgccccacgccaagctgtga

DBGET integrated database retrieval system