KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_74177Help
Entry
VOLCADRAFT_74177  CDS       T01330                                 

Gene name
pfk2
Definition
(RefSeq) phosphofructokinase family protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00010  Glycolysis / Gluconeogenesis
vcn00030  Pentose phosphate pathway
vcn00051  Fructose and mannose metabolism
vcn00052  Galactose metabolism
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01200  Carbon metabolism
vcn01230  Biosynthesis of amino acids
vcn03018  RNA degradation
Module
vcn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VOLCADRAFT_74177 (pfk2)
   00030 Pentose phosphate pathway
    VOLCADRAFT_74177 (pfk2)
   00051 Fructose and mannose metabolism
    VOLCADRAFT_74177 (pfk2)
   00052 Galactose metabolism
    VOLCADRAFT_74177 (pfk2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VOLCADRAFT_74177 (pfk2)
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VOLCADRAFT_74177 (pfk2)
Protein phosphatases and associated proteins [BR:vcn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VOLCADRAFT_74177 (pfk2)
Messenger RNA biogenesis [BR:vcn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VOLCADRAFT_74177 (pfk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK MTD EII-GUT
Motif
Other DBs
NCBI-GeneID: 9623918
NCBI-ProteinID: XP_002949213
JGI: 74177
UniProt: D8TRU2
Position
Unknown
AA seq 513 aa AA seqDB search
MRLQQRQVIGRSLPVCVPCVTRCRKLITVPRARPTPAATSGADLTTSYIIEPVSFGEDAV
LECPDMRSKLQPRPSPFVVHNNFGGGFVSDNDRVALNSMRFASAESAGASRTSGEGQAKS
SVNVLEASMDQLNMTLPPWAIRAGARKEIFFDPQQVTAAIVTCGGLCPGLNDVVQGLVNK
LTDYGVPEGKILGIKYGFRGFYDPSVKPVVLTKRVVDGIQLQGGTILGTSRGGANIREIV
KRIDMWGIDMLFVVGGNGGNAGANAINAMCRQHDVPCTVVGVPKSIDNDILLIDKCFGFD
TAVEESQRALLAAKVEASSARKGIGLVKLMGRQSGFIAMQASMASGVVDACLIPELNFKL
NGDQGLLRYLEGVIKNKGHCVVCVAEGAGQDLLEDGGQLGTDASGNPILKDIGAFLKEKF
KAYFKDADIKYIDPSYMIRSVSTTTNDRIYCKILAHNAVHAAFAGFTGITVGLVNTHYVY
LPIPVIIQAPRKVDPRGKAWNRLRAAIGQPSFT
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcaacagcgtcaagtaattggccgttctcttcctgtttgcgttccgtgcgtg
acacggtgccggaaactaatcacagttccgagggcaagaccaacccctgcggctacttca
ggcgcagaccttactactagttatataattgaacctgtcagctttggggaggatgctgtc
ttggagtgccccgatatgcgttcaaagctgcagccaaggcccagtccattcgttgtgcat
aacaactttggcggcggcttcgtatcggacaacgatcgagtggcccttaactcgatgcgc
tttgcgtccgctgagtcagctggtgccagtcgaacatccggggagggtcaggccaagagc
agcgtcaacgttctggaggcttccatggaccaactaaatatgacgttgccgccgtgggct
atccgggcgggggcgcggaaggaaatattctttgatccgcagcaggtgacagcggctatc
gtgacgtgcggtggactctgcccgggactcaacgacgtggtccagggtctcgtgaacaag
ctgacagactacggcgtaccggaggggaagatcctgggcattaagtacggcttcaggggc
ttctacgatcccagcgtcaagcccgtggtcctcaccaagcgtgtcgtggacggcatccag
ctccagggtgggactatcctgggcaccagccgcgggggagccaacatcagggaaatcgtg
aagcgcattgacatgtggggaatcgacatgttgttcgtggtcggcggcaacggcggcaac
gcaggtgccaatgccatcaatgccatgtgccgccagcacgacgtgccgtgcaccgtggtt
ggagtgcccaagtccattgataacgacatcctgctcattgacaagtgcttcggttttgac
acggcggtggaggagagccagcgcgcgctgctggcagccaaggtggaggccagcagtgca
cgaaagggcattggtctggtgaagctcatgggccgccagtcggggttcatcgccatgcag
gcatccatggccagcggtgtggtggacgcctgcctcatccctgagttgaacttcaagctc
aatggggaccaggggctgctgcgctacctggagggggtcatcaagaacaagggccactgc
gtggtgtgtgtggcggagggcgccggccaggacctcctcgaggatggcgggcagttgggc
actgacgcaagtggcaaccccattctgaaggatatcggcgccttccttaaggagaagttc
aaggcctacttcaaggacgccgatatcaagtacatcgacccgtcgtacatgatccgctcc
gtgtccacaaccaccaacgaccgcatctactgcaagatcttggcacacaacgccgtgcac
gcggcctttgccggcttcacgggtatcacggtggggctggtcaacacgcactacgtgtac
cttcccatcccggtcatcatccaggctcctaggaaggtggatccgcgcggcaaggcttgg
aaccgcttgcgtgccgccattggtcagccgagcttcacctaa

DBGET integrated database retrieval system