KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_74532Help
Entry
VOLCADRAFT_74532  CDS       T01330                                 

Gene name
cbr1
Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VOLCADRAFT_74532 (cbr1)
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     VOLCADRAFT_74532 (cbr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 291 aa AA seqDB search
MAPTQSLPPSLDDLLVFAKANWQLVLPVVVIILALALVLLLKRPKEKKPFLDPSEFKPLP
LTEKTYITHNTVRLRFSLPDPKQRLGLPIGQHITFLAKGDDGKDIYRPYTPVSDDDQLGS
VDFVIKIYPQGKMSQVIAKMRVGDTMLMKGPKGRFIYAPNMVKNFGMLAGGTGITPMFQV
LNAVLKDPKDRTRITLLYGNLTEDDILLRKELDQLVAMHGDRLSVFHVLNNPPASGWQGG
SGFITKEMIAERLPAPGPGHMVLRCGPTPMCNAMKQHLDELGFGEEAQFQF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcacctacacaatcattaccgccgtctttggatgatcttctagtatttgcaaaggca
aactggcagttggtgctgccggtcgtcgtcatcatcttggctttggcgctggtgttactg
ctgaagaggccgaaagaaaaaaagcctttccttgacccaagcgagttcaagccgttaccg
ctcacagagaaaacctatataacacataacactgtgcgtctccgattctcactaccggat
cctaagcaacgtttagggctgcccatcggtcagcacattacgttccttgcgaaaggtgac
gatgggaaggacatttaccggccttacaccccggtttccgatgatgaccagctgggcagc
gtcgatttcgtcatcaagatctaccctcaagggaaaatgtcgcaagtgatcgctaaaatg
cgagttggagatacaatgcttatgaaaggtcctaagggccgcttcatctacgcgcctaac
atggtgaagaattttggcatgctggcgggcggcacgggcatcacgcccatgtttcaggtg
ctcaatgcagtcctcaaggaccccaaggatcgtacccgcataacacttttgtacggtaat
ttgacggaggatgatatcctgcttcgcaaggagctcgatcagcttgtagccatgcacggt
gaccgcctgtccgtatttcacgtgctcaacaacccgccggcgagcggctggcaggggggc
agcggcttcatcactaaggaaatgattgcggagcgcctaccggcccctggccctggtcat
atggttctccgctgtgggcccacccccatgtgcaacgccatgaagcagcatctggacgaa
ttgggattcggggaggaggcgcagtttcagttttga

DBGET integrated database retrieval system