KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_75021Help
Entry
VOLCADRAFT_75021  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
vcn  Volvox carteri f. nagariensis
Brite
Protein phosphatases and associated proteins [BR:vcn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     VOLCADRAFT_75021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_9 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 9615560
NCBI-ProteinID: XP_002951476
JGI: 75021
UniProt: D8TYW3
Position
Unknown
AA seq 167 aa AA seqDB search
MGNQPGKSLGGRLTKKDIERLQRRFNRLANSSGKVNIAAFESMVELGGNPFIPRIFKLFD
ESGDGTLSLEEFTRALEYFGQLDVEEEQYKFAFRIYDEDKDGLISSEELFNVLQTLLGNA
YPDAQLEQVVHNTMSEFDRDGDNKLDLDEFKTLLSRQDLSNKFSMSM
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaccaaccaggcaaaagcttgggcgggcgactcaccaagaaggacatagagcgc
cttcagcgccgtttcaatcgacttgcaaatagctcgggaaaagtaaacatagctgccttt
gaatccatggttgagctggggggcaacccattcatcccgcggattttcaagcttttcgac
gagtctggagatggcacgctcagccttgaagagtttacacgggcgctggaatacttcggg
caactggacgttgaggaggagcaatacaaattcgcctttcggatctacgatgaggacaag
gacgggcttatttccagcgaggagctcttcaacgtgctccaaacgctgctgggtaacgcc
tacccggatgcgcagctcgagcaggttgtgcacaacacaatgagtgaattcgatcgggac
ggcgataacaagctggatctggacgagttcaaaacactgctttcacgacaggacctgtca
aacaagttttccatgtctatgtag

DBGET integrated database retrieval system