KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_75021Help
Entry
VOLCADRAFT_75021  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
vcn  Volvox carteri f. nagariensis
Brite
Protein phosphatases and associated proteins [BR:vcn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     VOLCADRAFT_75021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 167 aa AA seqDB search
MGNQPGKSLGGRLTKKDIERLQRRFNRLANSSGKVNIAAFESMVELGGNPFIPRIFKLFD
ESGDGTLSLEEFTRALEYFGQLDVEEEQYKFAFRIYDEDKDGLISSEELFNVLQTLLGNA
YPDAQLEQVVHNTMSEFDRDGDNKLDLDEFKTLLSRQDLSNKFSMSM
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaccaaccaggcaaaagcttgggcgggcgactcaccaagaaggacatagagcgc
cttcagcgccgtttcaatcgacttgcaaatagctcgggaaaagtaaacatagctgccttt
gaatccatggttgagctggggggcaacccattcatcccgcggattttcaagcttttcgac
gagtctggagatggcacgctcagccttgaagagtttacacgggcgctggaatacttcggg
caactggacgttgaggaggagcaatacaaattcgcctttcggatctacgatgaggacaag
gacgggcttatttccagcgaggagctcttcaacgtgctccaaacgctgctgggtaacgcc
tacccggatgcgcagctcgagcaggttgtgcacaacacaatgagtgaattcgatcgggac
ggcgataacaagctggatctggacgagttcaaaacactgctttcacgacaggacctgtca
aacaagttttccatgtctatgtag

DBGET integrated database retrieval system