KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_76537Help
Entry
VOLCADRAFT_76537  CDS       T01330                                 

Gene name
upf3
Definition
magnesium protoporphyrin chelatase
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VOLCADRAFT_76537 (upf3)
Enzymes [BR:vcn01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     VOLCADRAFT_76537 (upf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1398 aa AA seqDB search
MQHQTLLGRRAAHPAAGLTTKPAVPSPRVASTRQVACNVATGPRPPMTTFTGGNKPGNKP
VSLDLRDEGTGLFTSTSPELRRVVPDNVNGRVTVKVVYVVLEAQYQSAITAAVKNINAKN
SKVCFEVVGYLLEELRDAKNFEALKQDVATANIFIGSLIFIEELAEKIVEAVKPLRDQLD
ACLIFPSMPAVMKLNKLGTFSMSQLGQSKSVFSEFIKSARKNNDNFEEGLLKLVRTLPKV
LKYLPSDKAQDARNFVNSLQYWLGGNSDNLENLLLNVCSSYVPALKGVDFSVAEPQQYPD
VGVWHPLAPMMYEDLKEYLNWYDTRKDMTFAKDAPVIGLVLQRSHLVTGDEGHYSGVVAE
LESRGSKVIPVFAGGLDFSSPVKKFFYDPLGSGRPFVDTVVSLTGFALVGGPARQDAPKA
IEALKALNVPYLVSLPLVFQTTEEWLDSELGVHPVQVALQVALPELDGAIEPIVFAGRDS
NTGKSHSLPDRIASLCARAVNWARLRKKRNAEKRLAVTVFSFPPDKGNVGTAAYLNVFGS
IYRVLKNLQREGYDVGQLPPSEEDLIQSVLTQKEARFNSTDLHIAYKMKVDEYQRLCDYS
EALEENWGKPPGTLNTNGQELLIYGRQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGF
AAYYTYLEKIFKADAVLHFGTHGSLEFMPGKQVGMSGVCYPDSLIGTIPNVYYYAANNPS
EATIAKRRSYANTISYLTPPAENAGLYKGLKELKELISSYQGMRESGRAEQICATIIETA
RQCNLDKDVKLPEGEAKDLSMEDRDLIVGNVYRKLMEIESRLLPCGLHVVGCPPTAEEAV
ATLVNIAELDRPDNNPPIKGLPGILARAIGRDMEQVYSGNNKGILADVDCLQRITEACRA
CVREFVKDRTGLNGRIGTNFVTQLIKFTGFYVDPWVRALQNGEFAKADRQELITLFDYLE
FCLTQVVKDNELGALVEALNGQYVEPGPGGDPIRNPNVLPTGKNIHALDPQSIPTQAALK
SAKLVVDRLLDRERDNNGGKYPETIALVLWGTDNIKTYGESLAQVMMMVGVKPVPDALGR
VNKLEVIPLEELGRPRVDVVVNCSGVFRDLFVNQMLLLDRAIKLAAEQDEPDEMNFVRKH
AKQQAAELGLQSLRDAATRVFSNSSGSYSSNVNLAVENSSWSDESQLQEMYLKRKSYAFN
SDRPGAGGEMQRDVFEVAMKTVDVTFQNLDSSEISLTDVSHYFDSDPTKLVASLRNDGRT
PNAYIADTTTANAQVRTLGETVRLDARTKLLNPKWYEGMLASGYEGVREIQKRMTNTMGW
SATSGMVDNWVYDEANSTFIEDEAMAQRLMNTNPNSFRKLVATFLEANGRGYWDAKPEQL
ERLRQLYMDVEDKIEGVE
NT seq 4197 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatcagacgcttctcggccggcgcgccgcgcatccagcggcgggcctgaccacg
aagcctgctgtgcccagcccccgtgtggccagcacccgccaggttgcttgcaatgtggct
accgggccacggcctccgatgacgaccttcacaggcgggaacaagccaggcaataagcct
gtttcattggaccttcgtgatgaaggcactgggttgttcactagcaccagcccggagctg
cgccgtgtcgtcccggataacgtgaatgggcgtgtaacggtaaaagttgtgtacgtcgtg
ctggaggcccagtatcaatccgcaattaccgcggccgtaaagaacatcaacgcgaagaac
agcaaggtgtgtttcgaggtggttggttacctgctggaggagctccgcgacgcgaagaac
tttgaggcgcttaagcaggatgttgctaccgcgaatattttcatcggctctctcattttc
attgaggagctggctgaaaagattgtggaggctgttaagccccttcgcgaccagctggat
gcttgcctgatcttcccgtccatgccagctgttatgaagctgaacaagcttggcaccttc
tccatgtctcagctgggacagtcaaagtccgtgttttcggagttcatcaagtcggcccgg
aagaacaacgacaactttgaggagggtcttctgaagctggttcggactctgcccaaggtg
ctcaagtaccttccctcggataaagcccaggacgctcgcaactttgtaaacagtctgcag
tattggctgggtggaaactcggacaacctggagaacttgttgttgaatgtttgctcgtca
tatgtgcccgctctcaagggcgtggacttcagtgtagcagagccgcagcagtacccggat
gtgggtgtctggcatcctctggccccgatgatgtacgaggacctgaaagaatacctgaac
tggtacgacacccgcaaggacatgactttcgctaaggacgcgcctgtcattggtctggtg
ctccagcgctcgcatttggtgacgggtgacgagggtcactacagtggtgttgtagcggaa
ctggagagcaggggctctaaggttatcccggtctttgcaggtggcttggacttctcgtcg
ccggtgaagaagttcttttacgacccgctgggctcaggccgtcccttcgtggacacggtg
gtgtcgctgacgggattcgctttggttggtggccctgctcgccaagatgcccctaaggcc
attgaggctcttaaggccctcaatgtcccgtatctggtctccttgccgctggtcttccag
accacagaggagtggcttgacagcgagctcggcgtgcaccctgtgcaggtggctctgcag
gttgctcttcctgagctggacggcgctattgagcctattgtgtttgctggtcgcgactcc
aacacgggcaagtcgcactcattgccggatcggattgcctctttgtgtgctcgtgctgtg
aattgggcgcgtctgcgcaagaagcggaatgcggagaagcgcctggctgttacggtcttc
agcttcccgcctgacaagggcaatgtgggcacggcggcgtatttgaacgtattcggctct
atctaccgtgtgctgaagaaccttcagcgtgaaggctacgatgtgggtcagctgcccccg
tcggaggaggacctcattcagtcggtcctgacccagaaggaagcacgcttcaactcaact
gaccttcacattgcgtacaagatgaaggtcgacgagtaccagcggctctgcgactactcc
gaggcgctcgaggagaactggggcaagccaccgggtacgctgaacacaaatggccaggag
ctgctaatctacggccgccaatacggcaacgtcttcattggtgtacagccgacgtttggc
tacgagggcgacccgatgcgtctgctgttctcaaagagcgcttcgccgcatcacggcttc
gctgcctactacacctacctagagaagatcttcaaggccgatgcagtgctgcactttggc
actcacggctcgcttgagttcatgcccggcaagcaggtcggcatgtcaggcgtttgctac
cctgattccctaattggcaccatccccaacgtctactactacgctgcgaacaacccgtcg
gaggctaccatcgccaagcgccgctcttacgcgaacactatttcttaccttaccccgcct
gctgagaacgctggtctgtacaagggcctcaaggagcttaaggagctgattagcagctac
cagggcatgcgtgagagcggccgcgcagagcaaatctgtgccactatcattgagacggct
cgccagtgcaacctggacaaggatgtcaagctgcctgagggcgaagcaaaagatctgtca
atggaagaccgcgacctgatcgtgggcaacgtgtaccgcaagctgatggagatcgagtcg
cgcctgttgccatgcggcctgcacgtggtgggctgcccgcctacggccgaggaggcagtt
gctactctggttaacattgccgagctggaccgcccggataacaatccccccatcaagggc
ctgcctggcatcttggcgcgcgcaatcggccgcgacatggagcaggtctattcagggaac
aacaagggtattttggcagacgtcgactgcctgcagcgcattacagaggcttgccgtgcc
tgcgtgcgcgagtttgtgaaggaccgcacgggtctgaacggtcgcatcggcactaacttc
gtcacgcagctcattaagttcacgggcttctacgtggacccatgggtccgcgctctgcaa
aacggcgaattcgctaaggctgaccgccaggagctcatcactttattcgactacctcgag
ttctgcttgacgcaggttgtcaaggacaatgagctcggcgcgctggtggaggctctcaat
ggccagtacgtggagccaggaccaggcggcgatcctatccgcaaccctaacgttcttcca
acgggcaagaatatccacgctctcgacccccagtcgatcccaacccaggccgctttgaag
agcgctaagcttgttgtggatcgccttctcgaccgtgagcgcgacaacaacggcggcaag
taccctgagacaattgcgctggtcctctggggcacggacaacatcaagacttacggcgaa
tccctcgcccaggtaatgatgatggttggcgtcaagcctgtgccggatgcccttggtcgc
gtgaacaagctggaggtaattccgctggaggagctgggccgcccacgcgttgacgtcgtc
gtcaactgctcgggtgtcttccgcgacttgttcgtaaaccaaatgctgctcctggatcgc
gctatcaagctggctgcggagcaggatgagcctgatgagatgaacttcgttcggaagcat
gctaagcagcaggctgctgagttgggcctgcagagcctgcgcgatgctgccactcgtgtg
ttttcgaactcgtcgggttcttactcgtctaacgtcaacctggccgttgagaacagcagc
tggagcgatgagtcccagctgcaggagatgtatctgaagcgcaagtcgtatgccttcaac
tcggaccggccgggtgctggcggtgagatgcagcgcgacgtcttcgaagtggctatgaag
accgtcgacgtgacattccagaacctggattctagcgaaatctcactcacggatgtatcg
cactacttcgactccgaccccacgaagctggtggcttccttgcgcaacgacggccggact
ccgaatgcttatattgccgacaccaccacagcgaatgcgcaagtcaggacgctgggcgag
actgtccgcctcgacgcgcgcactaagctgctcaaccccaagtggtatgaaggtatgctt
gcctccggctatgagggtgtccgcgaaattcagaagcgcatgaccaacacgatgggctgg
tcggcgacgtcaggcatggtggacaactgggtttacgacgaggcgaactccacgttcatt
gaggacgaggcgatggcgcagcgtctgatgaacactaatccaaacagcttccgcaagctt
gtcgcgacgttcttggaggccaacggccgtgggtactgggacgccaagccggagcagctg
gagcggctgcggcagttgtacatggatgtggaggacaagatcgagggtgtcgagtaa

DBGET integrated database retrieval system