KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_76648Help
Entry
VOLCADRAFT_76648  CDS       T01330                                 

Gene name
mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K14512  mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn04016  MAPK signaling pathway - plant
vcn04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    VOLCADRAFT_76648 (mapk8)
   04075 Plant hormone signal transduction
    VOLCADRAFT_76648 (mapk8)
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     VOLCADRAFT_76648 (mapk8)
Protein kinases [BR:vcn01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   VOLCADRAFT_76648 (mapk8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo Kinase-like APH FTA2
Motif
Other DBs
NCBI-GeneID: 9616382
NCBI-ProteinID: XP_002955338
JGI: 76648
UniProt: D8U9G8
Position
Unknown
AA seq 397 aa AA seqDB search
MAEHNDLSFTTEAVAEHKDGEGLKEAQIGLQEQVEVTGKFDSHNREYNQFLVCGSLFECP
AKYLPIKPIGKGAYGVVCSAKNLDSQEKVAIKKIANAFDNVIDAKRTLREIKLLKHLQHE
NIVQIKDIIPPMQRDAFKDLYVVYELMDTDLHQIIRSPQQLSNDHSQYFLYQLLRGLKYI
HSANILHRDLKPSNLLVNANCDLKICDFGLARTSTSNEKEFMTEYVVTRWYRAPELLLSC
SGYTTAIDVWSVGCIFAELLGRKPLFPGKDYVHQLSLITKIIGSPSEGELGFITSEKAKR
YIRSLPRSVRVDFAQLWPHANKQALDLIDKMLVFDPTKRITVEQALEHPYLASLHDVADE
PVCATPFTFDFDADHLTPDVVRDVILQDMTELHENVP
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacataatgaccttagctttacaacagaggcagtggcggaacataaggatggg
gagggcctgaaggaggctcagattggacttcaggagcaagtggaagtaactggaaagttt
gattcacacaaccgggaatacaaccagttcctggtgtgcggcagcctctttgaatgccct
gccaagtatttgccgataaagcctatcggcaagggggcctatggggttgtctgctctgcc
aagaatttggactcccaggaaaaggtcgcgatcaagaaaattgctaacgcgttcgacaat
gtcatcgacgccaagcgcacgctgcgggaaattaagttgctgaagcacttgcagcatgaa
aacattgttcaaatcaaggatatcatccctccaatgcagcgggatgcgttcaaggatttg
tatgtcgtgtacgagctgatggacaccgacttgcatcaaatcatccggtcgccgcagcag
ctgtcaaacgaccacagtcaatatttcttatatcagctgcttcgagggctcaagtacatc
cacagcgccaacatcctccatcgcgatctcaagccctccaacctgctggtcaacgccaac
tgcgacctgaagatctgcgactttgggctggccaggaccagcacgagcaacgagaaggag
ttcatgacggagtacgtggtgacgcggtggtatcgggcaccggagctgctgctgagctgt
tcgggatacacgaccgccattgacgtatggtccgtgggctgtatctttgctgagctgctg
ggtcgcaagccgctgttcccgggcaaggactacgtgcaccagctgagcctcatcacgaag
atcatcggctctcccagcgagggggagctgggcttcatcacctcggagaaggccaagcgc
tacatccggtcgctgccacggagcgtgcgagtagactttgcgcagttgtggccacacgcc
aacaagcaggccctggacctaatcgacaaaatgctggtgttcgaccccacaaagcgcatt
acagtggagcaggcgctggagcacccctacctggcctccctgcatgatgtagcggatgag
cccgtgtgcgcaacacccttcaccttcgacttcgacgccgaccacctgacgccggacgtc
gtacgggacgtcattttgcaggacatgacggagctacacgaaaacgtgccatga

DBGET integrated database retrieval system