KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_76826Help
Entry
VOLCADRAFT_76826  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VOLCADRAFT_76826
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VOLCADRAFT_76826
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    VOLCADRAFT_76826
Enzymes [BR:vcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     VOLCADRAFT_76826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 186 aa AA seqDB search
MAAIVAKSSVASAVARPSRNSVQRSVAALKPAVKAAPVTAPAQANKMMVWTPVNNKMFET
FSYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESTVRFGPVSCLYYDNRYWT
MWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNVKQVQIMGFLVQRPKSARDWQP
ANKRSV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggccgctattgttgctaaatcatctgtggccagcgcagtggcgcgcccatcccgcaac
agcgttcagcgttctgttgcagctctgaagccggctgtcaaggctgccccggtcactgct
ccggcccaggctaacaagatgatggtctggaccccggtgaacaacaagatgttcgagacc
ttttcctacctgccccctctgactgacgagcagatcgctgctcaggttgactacatcgtt
gctaatggctggattccttgccttgagttcgctgaggccgacaaggcctacgtgtcgaac
gagtcgaccgtccgcttcggcccagtctcctgcctgtactacgacaaccgctactggacg
atgtggaagctgcccatgttcggctgccgcgacccgatgcaggtgctgcgcgagatcgtt
gcctgcaccaaggccttcccggacgcctacgtgcgcctggtggccttcgacaacgtgaag
caggtgcagatcatgggcttcctggtgcagcgccccaagagcgcccgcgactggcagccg
gccaacaagcgctccgtctaa

DBGET integrated database retrieval system