KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_76826Help
Entry
VOLCADRAFT_76826  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00630  Glyoxylate and dicarboxylate metabolism
vcn00710  Carbon fixation in photosynthetic organisms
vcn01100  Metabolic pathways
vcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VOLCADRAFT_76826
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    VOLCADRAFT_76826
Enzymes [BR:vcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     VOLCADRAFT_76826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 9626479
NCBI-ProteinID: XP_002955680
JGI: 76826
UniProt: D8UAG8
Position
Unknown
AA seq 186 aa AA seqDB search
MAAIVAKSSVASAVARPSRNSVQRSVAALKPAVKAAPVTAPAQANKMMVWTPVNNKMFET
FSYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESTVRFGPVSCLYYDNRYWT
MWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNVKQVQIMGFLVQRPKSARDWQP
ANKRSV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggccgctattgttgctaaatcatctgtggccagcgcagtggcgcgcccatcccgcaac
agcgttcagcgttctgttgcagctctgaagccggctgtcaaggctgccccggtcactgct
ccggcccaggctaacaagatgatggtctggaccccggtgaacaacaagatgttcgagacc
ttttcctacctgccccctctgactgacgagcagatcgctgctcaggttgactacatcgtt
gctaatggctggattccttgccttgagttcgctgaggccgacaaggcctacgtgtcgaac
gagtcgaccgtccgcttcggcccagtctcctgcctgtactacgacaaccgctactggacg
atgtggaagctgcccatgttcggctgccgcgacccgatgcaggtgctgcgcgagatcgtt
gcctgcaccaaggccttcccggacgcctacgtgcgcctggtggccttcgacaacgtgaag
caggtgcagatcatgggcttcctggtgcagcgccccaagagcgcccgcgactggcagccg
gccaacaagcgctccgtctaa

DBGET integrated database retrieval system