KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_76826Help
Entry
VOLCADRAFT_76826  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vcn01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vcn00630]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:vcn00710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 186 aa AA seqDB search
MAAIVAKSSVASAVARPSRNSVQRSVAALKPAVKAAPVTAPAQANKMMVWTPVNNKMFET
FSYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESTVRFGPVSCLYYDNRYWT
MWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNVKQVQIMGFLVQRPKSARDWQP
ANKRSV
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggccgctattgttgctaaatcatctgtggccagcgcagtggcgcgcccatcccgcaac
agcgttcagcgttctgttgcagctctgaagccggctgtcaaggctgccccggtcactgct
ccggcccaggctaacaagatgatggtctggaccccggtgaacaacaagatgttcgagacc
ttttcctacctgccccctctgactgacgagcagatcgctgctcaggttgactacatcgtt
gctaatggctggattccttgccttgagttcgctgaggccgacaaggcctacgtgtcgaac
gagtcgaccgtccgcttcggcccagtctcctgcctgtactacgacaaccgctactggacg
atgtggaagctgcccatgttcggctgccgcgacccgatgcaggtgctgcgcgagatcgtt
gcctgcaccaaggccttcccggacgcctacgtgcgcctggtggccttcgacaacgtgaag
caggtgcagatcatgggcttcctggtgcagcgccccaagagcgcccgcgactggcagccg
gccaacaagcgctccgtctaa

DBGET integrated database retrieval system