KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_77404Help
Entry
VOLCADRAFT_77404  CDS       T01330                                 

Gene name
gon15
Definition
protein disulfide isomerase 1
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    VOLCADRAFT_77404 (gon15)
Enzymes [BR:vcn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VOLCADRAFT_77404 (gon15)
Exosome [BR:vcn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VOLCADRAFT_77404 (gon15)
  Exosomal proteins of colorectal cancer cells
   VOLCADRAFT_77404 (gon15)
  Exosomal proteins of bladder cancer cells
   VOLCADRAFT_77404 (gon15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 524 aa AA seqDB search
MPRWSLLALLFGLLLVAAPFSKHQLAWASDEYDEDDDDEAPADDDKDVVVVTTKNFDDVV
KKSKFALVEFYAPWCGHCKSLKPQYAAAATTLKKVAPDAVLAKVDATVEESLAGKFGIQG
YPTLKWFVDGELVSDYNGPRDAEGIVNWIKKKTGPSAVTVDDVDKLQELEADNEVLAVGY
FSAFEGEAFEAFISYAKKTESVSFAQTTSAEVAKAAGLEAPGTLAVVKNFKDEPRATVVL
AELDEEKIADFVKSEKLPLTIEFSKGNSDKIFNSGIPMQLILWTSAKDLESGAEVRTIYK
TVASKFKGKLVFVTVNNEGEEADPVTNFFGLKGAASPVLLGFYMEKNKKYKLQEPFTLEA
VEKFAESILDGTAQPEYKSQPIPEDPYEDGVHVVVGKSVDSVVLDPTKDVLLEVYAPWCG
HCKKLDPIYKKLAKRFKKVSSVVIAKMDGTENEHPLVDVKGFPTLIFFPAGEDATPIPFE
GGDRTLKSLTKFIKANAKVPYELPKKSSAEESAADDAPSAKDEL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgttggagccttcttgcccttctatttgggctgctcttagtggcagcccctttt
tctaagcaccagctcgcatgggcatcagacgaatatgacgaggacgacgatgacgaagcg
cctgctgatgacgataaggatgttgtggttgtgaccaccaagaactttgatgatgtcgtc
aagaagtcgaaattcgcccttgtagaattctacgcgccatggtgcggtcactgcaagagc
ttgaaaccgcaatacgctgccgctgccaccactctcaagaaggttgctccagatgcagtc
cttgcaaaggtcgatgccaccgtcgaggagtcattggcaggcaaattcggcattcagggg
taccccaccctgaagtggttcgtcgacggcgagctggtgtcggactacaacggcccccgt
gacgctgagggtattgtgaactggattaagaagaagaccggcccctccgccgtgaccgtc
gatgatgtggacaagctgcaggagctcgaggccgacaacgaggttctcgctgttggctat
ttcagcgccttcgagggagaggctttcgaggccttcatctcctacgccaagaagacggag
tcggtttcgtttgcgcagaccacctcggctgaggttgccaaggctgcaggtctggaggcg
cctggcactctggctgttgtgaagaacttcaaggatgagcctcgggcgaccgtcgtgctg
gccgaacttgacgaggagaagattgcagatttcgtcaagagtgagaagctgccgctcacc
atcgagttcagcaagggcaactcggataagattttcaacagcggcatccccatgcagctt
atcctttggacgagcgccaaggacctggaatctggcgccgaggtgcgcaccatctacaag
acggtggcatccaagtttaagggcaagctggtgtttgtgactgtgaacaatgagggcgag
gaagccgatcccgtcacgaacttcttcggcctcaagggcgccgcttcgccagtgctgctg
ggcttctacatggagaagaacaagaagtacaagctgcaggagcccttcaccctggaggcc
gtggagaagtttgctgagtccattctggatggcaccgctcagcccgagtacaagagccag
cctattccggaggatccctacgaggatggcgtccacgtggtggtcggcaagtccgttgac
agcgttgtcctggaccccacgaaggatgtgctgcttgaggtgtacgcgccgtggtgcggc
cactgcaagaagcttgaccccatctacaagaagctggctaagcggttcaagaaggttagc
tctgtcgtcattgctaagatggacggcactgagaatgagcatcccctagtcgacgtcaag
ggcttcccaaccctcatcttcttccccgcgggcgaggacgccaccccgattcctttcgag
ggcggtgatcgcacgctgaagagcctgaccaagttcattaaggctaacgccaaggttccc
tacgagctgcccaagaagagcagcgccgaggagagcgctgccgatgatgcgccttccgcg
aaggatgagctgtaa

DBGET integrated database retrieval system