KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_78734Help
Entry
VOLCADRAFT_78734  CDS       T01330                                 

Definition
mRNA export protein-like protein
Orthology
K14298  
mRNA export factor
Organism
vcn  Volvox carteri f. nagariensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    VOLCADRAFT_78734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 353 aa AA seqDB search
MFGAAAAQAKPAHNPNGDLEVPAPADLDSISSLTFSPASDFFAVTSWNNSAYVWQYNAQG
QTFAKAQNTGTQPVLTSCWKHDGSGIFLGGCDKAVRLWDLASNQAVQVAMHDAPVRQVTW
CPQMNLLITGSWDKTFRYWDTRSPTPAHTGALPERVYAMDLREDLLVIGTADRSLHALFV
TQPQQIKTLPSQLKWQTRCVAVFPDKKGFLVGSIEGRVAVSHLSEQDQKDKNFTFKCHRL
ETEIYSVNTMSFHNTYGTFVTAGSDGTYNFWDKDSKQRLKAQAKAMYPNGQPAPITCGSF
DRTGTIYGYALSYDWSKGYAEYNPATMKPYIMLHSCKEDEVKPKPKTLTAGRK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcgcggcagccgcgcaggcaaagccggcgcataacccaaacggcgacttggag
gtgccggcaccagctgacttggactccataagtagccttactttcagtccagcaagcgat
ttctttgccgtgacatcctggaacaatagtgcctacgtatggcaatataatgcacaaggg
caaactttcgctaaggcgcaaaataccggaactcagccagtccttacaagttgttggaaa
cacgatggaagcggtatctttctgggcggctgtgacaaggcggtccggctctgggacttg
gcaagcaaccaggcagtgcaggtggctatgcacgatgcgccagtgcggcaggtaacatgg
tgcccgcagatgaatctactgataactggctcgtgggacaaaacattccggtattgggac
acgaggtcccccacgcctgcgcacacgggcgcactcccggagcgggtttacgccatggac
ctgcgggaagacctgctagttatcggcacggcggaccgcagcctgcacgccctattcgtc
acgcagccgcagcagatcaagaccttaccgtcacagcttaaatggcagacgcgctgcgtg
gcagtgtttcccgacaagaagggattccttgttggctccatcgaaggccgtgtggccgtg
tcccatctcagtgaacaggaccaaaaggacaagaacttcaccttcaagtgccacaggctc
gagaccgagatttactcggtcaacacgatgtcgttccataacacgtacggcaccttcgtc
acggcgggctcagatggcacatataatttttgggacaaagactccaagcagcggctcaag
gcgcaggccaaggccatgtaccccaatggtcagcccgcgccgataacttgtggctccttt
gaccggacgggcaccatttatggctatgcactcagctacgattggagcaagggatacgcg
gagtacaaccccgcaaccatgaagccgtacatcatgttgcactcgtgcaaggaggatgag
gtgaagcccaagcccaagaccctcactgctgggcggaagtga

DBGET integrated database retrieval system