KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_80080Help
Entry
VOLCADRAFT_80080  CDS       T01330                                 

Gene name
mapk3
Definition
mitogen-activated protein kinase 3
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
vcn  Volvox carteri f. nagariensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 381 aa AA seqDB search
MSQAGSQAQGSQSASSSSSSSNIPVRQECNIPGKARWVLWRTTFEIDEKYQPIKAIGKGA
YGVVCSAKNLQTNEKVAIKKIGNAFENLTDARRTLREIKLLRHLKHENVIAVKDILKPPS
KDKFNDVYLVYELMDTDLHQIIRSSQPLTNEHFQYFIYQVLRGLKYVHTANVLHRDLKPS
NLLLNASCDLKICDFGLARTSAEQNNFMTEYVVTRWYRAPELLLSCETYNAAIDMWSVGC
IMAELLGRKPLFPGKDYVDQLKLIIKTLGPPSEDDLTFIRSQKACAYIRALPPSEKVNFR
RKFPDADPLAIDLMEKMLQFDPRKRIDVHQALKHPWLAQLHDEAAEPCAPGEFVLDFDEA
SLTEQNVRELIYEELITHYHS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagcaggttcgcaagcgcagggctcacagtctgcttcctccagcagctcaagt
agcaatatcccggtgcgtcaagagtgcaacattccaggcaaggcccgatgggtcctttgg
cgaactacgtttgaaatagacgaaaaataccaacctatcaaggcaattggcaagggtgct
tatggcgtagtttgctctgcaaagaacttacaaactaacgagaaggttgctattaaaaag
atcggaaatgcttttgagaacttaacggacgcacggcggactctgcgcgagattaagctg
ctacggcacctgaagcacgagaatgtgatcgccgtcaaggacatcctcaagccaccgtcg
aaggacaagttcaacgatgtctacttggtttacgagcttatggacacggaccttcaccag
atcattcgctcgtcgcagccccttacaaacgaacacttccaatatttcatctaccaggtg
ctgcggggtctcaagtacgtgcacaccgcaaacgtgcttcaccgtgacctcaagcccagc
aaccttctgctgaatgcatcctgcgatctgaaaatctgtgactttggactggcgcgaacc
agtgcggagcaaaacaatttcatgactgaatacgtcgtcacgcgctggtaccgcgcgccc
gagctgctattgtcatgcgagacgtacaacgccgcgatcgatatgtggtcggtaggctgc
atcatggctgagctgcttggccgcaagccgctgttcccggggaaagactacgtggaccag
ctaaagctcatcatcaagacactaggtccgccgtcggaggacgacctcacgttcatcagg
agccaaaaggcgtgcgcctatatcagggcgcttccaccttccgagaaagtaaatttccgc
aggaagttcccagatgcggatccactggcgattgacttaatggagaagatgttgcagttc
gacccacgcaagcggatcgacgtgcaccaggcgctcaagcatccctggctggcgcagttg
cacgatgaggcagcagagccgtgcgcaccgggtgagttcgtgcttgactttgacgaggcg
agccttacagagcagaatgtgcgtgagcttatttacgaggagttaattactcactatcac
agctga

DBGET integrated database retrieval system