KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_80080Help
Entry
VOLCADRAFT_80080  CDS       T01330                                 

Gene name
mapk3
Definition
mitogen-activated protein kinase 3
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     VOLCADRAFT_80080 (mapk3)
Protein kinases [BR:vcn01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   VOLCADRAFT_80080 (mapk3)
Exosome [BR:vcn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VOLCADRAFT_80080 (mapk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 381 aa AA seqDB search
MSQAGSQAQGSQSASSSSSSSNIPVRQECNIPGKARWVLWRTTFEIDEKYQPIKAIGKGA
YGVVCSAKNLQTNEKVAIKKIGNAFENLTDARRTLREIKLLRHLKHENVIAVKDILKPPS
KDKFNDVYLVYELMDTDLHQIIRSSQPLTNEHFQYFIYQVLRGLKYVHTANVLHRDLKPS
NLLLNASCDLKICDFGLARTSAEQNNFMTEYVVTRWYRAPELLLSCETYNAAIDMWSVGC
IMAELLGRKPLFPGKDYVDQLKLIIKTLGPPSEDDLTFIRSQKACAYIRALPPSEKVNFR
RKFPDADPLAIDLMEKMLQFDPRKRIDVHQALKHPWLAQLHDEAAEPCAPGEFVLDFDEA
SLTEQNVRELIYEELITHYHS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagcaggttcgcaagcgcagggctcacagtctgcttcctccagcagctcaagt
agcaatatcccggtgcgtcaagagtgcaacattccaggcaaggcccgatgggtcctttgg
cgaactacgtttgaaatagacgaaaaataccaacctatcaaggcaattggcaagggtgct
tatggcgtagtttgctctgcaaagaacttacaaactaacgagaaggttgctattaaaaag
atcggaaatgcttttgagaacttaacggacgcacggcggactctgcgcgagattaagctg
ctacggcacctgaagcacgagaatgtgatcgccgtcaaggacatcctcaagccaccgtcg
aaggacaagttcaacgatgtctacttggtttacgagcttatggacacggaccttcaccag
atcattcgctcgtcgcagccccttacaaacgaacacttccaatatttcatctaccaggtg
ctgcggggtctcaagtacgtgcacaccgcaaacgtgcttcaccgtgacctcaagcccagc
aaccttctgctgaatgcatcctgcgatctgaaaatctgtgactttggactggcgcgaacc
agtgcggagcaaaacaatttcatgactgaatacgtcgtcacgcgctggtaccgcgcgccc
gagctgctattgtcatgcgagacgtacaacgccgcgatcgatatgtggtcggtaggctgc
atcatggctgagctgcttggccgcaagccgctgttcccggggaaagactacgtggaccag
ctaaagctcatcatcaagacactaggtccgccgtcggaggacgacctcacgttcatcagg
agccaaaaggcgtgcgcctatatcagggcgcttccaccttccgagaaagtaaatttccgc
aggaagttcccagatgcggatccactggcgattgacttaatggagaagatgttgcagttc
gacccacgcaagcggatcgacgtgcaccaggcgctcaagcatccctggctggcgcagttg
cacgatgaggcagcagagccgtgcgcaccgggtgagttcgtgcttgactttgacgaggcg
agccttacagagcagaatgtgcgtgagcttatttacgaggagttaattactcactatcac
agctga

DBGET integrated database retrieval system