KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_81085Help
Entry
VOLCADRAFT_81085  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     VOLCADRAFT_81085
Protein kinases [BR:vcn01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   VOLCADRAFT_81085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 334 aa AA seqDB search
MGPLLPVMTKEAEAYLRQGANWKPQNKAFNVADAQAVAVLGAGGFGQVLLVKYKGSYHAL
KAISKAFVKEQGLVEHVKREKELMSECDSPFLVRLAGTATDDTTLYMMMEAVMGGELFAY
LQTRTRPLDENHARFYAASVVLALEYLHDRDMVYRDLKPENLLIDLQGYLKVTDFGFVKR
LRKGTKTFTLCGTPEYLAPEIIMNNGHNGAADWWALGVLIFELCNGLPPFMDDDRLAMFR
KICNRDLTFPKHFSSNLRHLIERLLDPNPLFRTGAGREGAAEIKSHPWFANFDWDKFQAK
QLPAPYIPKQPSHAGDTCNFAPMQVRDTCGRRRR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggccccttgctgcctgtcatgaccaaggaagcggaggcctacctccggcagggcgcc
aactggaagccgcagaacaaggcattcaacgtcgcggacgcacaggccgtggcggtgctg
ggcgcggggggcttcggacaggtcctgttggtgaagtataagggtagctatcatgccttg
aaggcgatcagcaaggcgtttgtaaaggagcaggggttggtggaacacgtcaaacgagag
aaggaactcatgtcggagtgcgactctcccttccttgtacggctcgcgggtacggcaacg
gatgacacgacgctgtacatgatgatggaagcggtcatgggcggcgagctcttcgcctac
ctacagactcgtacgcggcctctagacgagaaccacgcccgcttctacgcggcctccgtt
gtcctcgccctggaatacctccacgatagggatatggtgtatcgggatctcaagcccgag
aacctgctcatcgatcttcaggggtacctcaaggtaacggactttggcttcgtgaagcgg
ctacgaaagggcaccaagaccttcacgctgtgcgggacacccgagtacctagcaccagag
attataatgaacaacggccacaacggcgcagcggattggtgggcgctgggtgtgctcatc
ttcgagctgtgcaacggcctgccgcctttcatggatgatgaccggttggccatgttcagg
aagatctgcaaccgggaccttaccttccccaagcacttctcgagcaacctacgtcatctg
attgagagactgctggaccccaacccgctgtttcgtacgggtgcgggccgtgaaggggcc
gcggagatcaaatcacacccttggttcgcaaacttcgactgggataagttccaagccaag
cagcttcccgcgccctacatccccaagcaaccctcacacgcgggtgacacctgcaacttc
gcacccatgcaggtgcgggatacctgcggacgtagaaggagatga

DBGET integrated database retrieval system