KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_81085Help
Entry
VOLCADRAFT_81085  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
Organism
vcn  Volvox carteri f. nagariensis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 334 aa AA seqDB search
MGPLLPVMTKEAEAYLRQGANWKPQNKAFNVADAQAVAVLGAGGFGQVLLVKYKGSYHAL
KAISKAFVKEQGLVEHVKREKELMSECDSPFLVRLAGTATDDTTLYMMMEAVMGGELFAY
LQTRTRPLDENHARFYAASVVLALEYLHDRDMVYRDLKPENLLIDLQGYLKVTDFGFVKR
LRKGTKTFTLCGTPEYLAPEIIMNNGHNGAADWWALGVLIFELCNGLPPFMDDDRLAMFR
KICNRDLTFPKHFSSNLRHLIERLLDPNPLFRTGAGREGAAEIKSHPWFANFDWDKFQAK
QLPAPYIPKQPSHAGDTCNFAPMQVRDTCGRRRR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgggccccttgctgcctgtcatgaccaaggaagcggaggcctacctccggcagggcgcc
aactggaagccgcagaacaaggcattcaacgtcgcggacgcacaggccgtggcggtgctg
ggcgcggggggcttcggacaggtcctgttggtgaagtataagggtagctatcatgccttg
aaggcgatcagcaaggcgtttgtaaaggagcaggggttggtggaacacgtcaaacgagag
aaggaactcatgtcggagtgcgactctcccttccttgtacggctcgcgggtacggcaacg
gatgacacgacgctgtacatgatgatggaagcggtcatgggcggcgagctcttcgcctac
ctacagactcgtacgcggcctctagacgagaaccacgcccgcttctacgcggcctccgtt
gtcctcgccctggaatacctccacgatagggatatggtgtatcgggatctcaagcccgag
aacctgctcatcgatcttcaggggtacctcaaggtaacggactttggcttcgtgaagcgg
ctacgaaagggcaccaagaccttcacgctgtgcgggacacccgagtacctagcaccagag
attataatgaacaacggccacaacggcgcagcggattggtgggcgctgggtgtgctcatc
ttcgagctgtgcaacggcctgccgcctttcatggatgatgaccggttggccatgttcagg
aagatctgcaaccgggaccttaccttccccaagcacttctcgagcaacctacgtcatctg
attgagagactgctggaccccaacccgctgtttcgtacgggtgcgggccgtgaaggggcc
gcggagatcaaatcacacccttggttcgcaaacttcgactgggataagttccaagccaag
cagcttcccgcgccctacatccccaagcaaccctcacacgcgggtgacacctgcaacttc
gcacccatgcaggtgcgggatacctgcggacgtagaaggagatga

DBGET integrated database retrieval system