KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_81219Help
Entry
VOLCADRAFT_81219  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     VOLCADRAFT_81219
Protein kinases [BR:vcn01001]
 Serine/threonine kinases: AGC group
  PKG family
   VOLCADRAFT_81219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Kinase-like APH DUF2459
Motif
Other DBs
NCBI-GeneID: 9618257
NCBI-ProteinID: XP_002950834
JGI: 81219
UniProt: D8TWG5
Position
Unknown
AA seq 718 aa AA seqDB search
MGNSQGKGDVATTGRAIAITGGAVKGKATLPKLPANAVKAQPEDYSFIENALGRLLLFTR
LDPQLQRKIVSEMYERTVPAGDILIKEGDTGLAASELYVVKSGKFEVLQKRQGQNVRVNI
KERGDCFGEISLMYDSPRTATVAATMDAVVWALDRQVFRFFVRELQETQVSQVELFLNSV
PILANLSREERIRLVDAFEEVTYQAGQKVIVEGDKGDLFYIVKDGEAIVYQNTPQGQRKV
NHLFKADFFGERALLKDEPRMATVEAYTKLICLTLKRETFQEILGPLEQLMAREKSNQVV
AQKMAKLQPRGSNVHRPLADVLIKRKKKGRNGDTWEVVRARGHLDEVSELRKGGTKLDGL
ESGTSGKESIALVLTEGTVLGGGAFSRVSIVMEESTGRQYALKRMRKSAVVQCPEHVFCE
QAITKNVAHPFCIRQYASGSDKYHLYFLFDLMPGGDLMDVLVAEAKVIRRRVPQGNWRIG
CLAPKVKMLQGMSEDLAKFYIGSIVLALEYLHNNNIVYRDLKPENVFIDGSGYVKLGDFG
FAKVLENGNRTYTFCGTPGYVAPENVLAHGYNYSVDWWGLGVLMYVLLTGRQPFSTPKTD
DPMVVMRRIVDENYQIKYPPYLSQAAKDLIARLLERKPAKRLGMLNARALDIKNHKWFEN
LPWEELEARRMGAPRKPKEADSSKRLKEMIENEKKTAGKTPKETPEELQECEMVFADF
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggggaactcgcagggcaagggtgatgtggcgaccaccggccgtgccattgccattacc
ggcggagccgtgaagggaaaggccacgctgcccaagctgccggcaaatgctgttaaggct
cagccggaggactactcgttcatcgagaatgctctgggacggctactattgttcacaagg
ttagacccacaacttcaacggaagattgtgtccgaaatgtatgaacggactgtgccggcg
ggagacattctaatcaaagagggcgataccggtcttgctgcttccgagctatacgtcgtt
aagagcggcaaatttgaggtgcttcaaaagcgacaggggcaaaatgtccgcgtcaacatt
aaggagcgcggcgactgcttcggcgaaatctctctgatgtatgacagccctcgaacagcc
accgtagcggccactatggacgcagttgtatgggcgcttgaccgccaagtgttcaggttt
tttgtgagagagctccaggaaacccaggtatcacaggttgagctgttcttgaacagcgtg
cctatcctggccaacctgtcgcgcgaggagcgcatccgccttgtggacgcgttcgaggaa
gttacgtaccaggccgggcaaaaggttatcgtggagggtgataagggtgacctattttac
atcgtcaaagatggggaggccatcgtgtaccaaaacacaccccagggccagcgcaaagtg
aaccaccttttcaaggcggacttcttcggcgagcgcgctctgctaaaagatgaacccaga
atggcaaccgtggaggcttacacgaagctcatttgcctcacactaaagcgtgaaacattc
caggagatcttaggtccgctggaacaacttatggcgcgcgagaaatcgaaccaggtggtg
gcgcagaagatggccaagctgcaaccccgtggctccaacgtacatcggccgttggcggac
gtgctgatcaagcggaaaaagaagggacgcaacggggacacctgggaggtggtgcgtgcg
cgcgggcacttggatgaggtgtcggagctccgtaaaggcggcaccaagctggacggcttg
gagtccgggacgtcgggtaaggagagcatcgcgctggtccttacagaagggacggtgctt
ggcggtggtgctttcagccgagtatcgattgtcatggaggagtcaaccggtcggcagtac
gcgctgaagcgcatgcgcaagtcggccgtggtgcagtgtccggagcacgtcttttgcgag
caggcgatcacgaagaatgtggcacatccgttctgcatccgccaatacgcatctggttcc
gacaagtaccacctgtacttcctgtttgacctgatgcccggcggcgatctgatggatgtg
ctggtggcggaggccaaggtcatcaggcgccgcgtgccgcagggcaactggcggataggc
tgcctagctcccaaggtgaagatgctgcaggggatgagcgaggacctggccaagttttac
atcggttccatcgtcctggcgctcgaatacctgcacaacaacaacatagtgtaccgcgac
ctgaagcccgagaacgtcttcattgatggcagcggctacgtgaagctgggcgactttggt
ttcgccaaggtgcttgagaacggcaacaggacttacaccttctgcggcacgcccggctac
gtggcgccggagaatgtgctggcgcacggctacaactacagcgttgactggtggggcctg
ggcgtgctgatgtacgtgcttctgacgggtcgccagcctttcagcaccccaaagacggac
gatcccatggtggtcatgcgccgcattgtggacgagaactaccagatcaagtacccgccg
tacctttcgcaggcggccaaggacctgattgcaagactattggaacgcaagccggcgaaa
cgcctgggcatgcttaacgcgcgggcgctggatattaagaaccacaagtggtttgagaac
ctgccttgggaggaactggaagcgcgcaggatgggtgcgccacgcaagcctaaggaggcc
gacagcagtaagcgcctcaaggaaatgattgagaatgagaagaagaccgcgggcaagacc
ccgaaggagacgccagaggagctgcaggagtgcgaaatggtctttgcggacttctga

DBGET integrated database retrieval system