KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_81346Help
Entry
VOLCADRAFT_81346  CDS       T01330                                 

Gene name
mapk5
Definition
mitogen-activated protein kinase 5
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
vcn  Volvox carteri f. nagariensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 336 aa AA seqDB search
MTEEEVDKHILKKYEIQQKLGKGAYGVVWKAVDRKTREVVALKKIFDAFQNATDAQRTFR
EVMFLQDLNNHDNIIRLLNVLKAENDRDLYLVFEYMETDLHAVIRANILEEVHKQYIMYQ
LFKALKYMHSGELLHRDIKPSNLLLNSDCQVKLADFGLARSVSQLNASDGQNPILTDYVA
TRWYRAPEILLGSTKYTFGVDMWSSGCILGELLLGKPIFPGTSTMNQLDRIVEFCGRPAP
ADVEAIDSPFATTMMDSCTVTASRRLADIFPNASPEAADLLRKLLVFNPHKRLTAEQALR
HPYVAQFHNMADEPVCNRIIVLPISDNTKYTVSEYR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagaggaggtcgataagcacatacttaaaaagtatgagattcagcaaaagctt
ggcaagggggcctatggcgttgtctggaaagcggttgaccgcaagacgcgggaggtggtc
gcgctgaagaaaatttttgacgcgtttcaaaacgcgacagacgctcagagaacatttcga
gaagtaatgtttctccaggatcttaacaaccacgacaacatcatcagattactgaacgtg
ctcaaagctgaaaatgatcgcgatctctacctcgtatttgagtatatggagacggacctg
cacgctgtcattcgggcaaacatcctggaagaagtgcacaagcagtacatcatgtaccaa
ctcttcaaagcgctgaagtacatgcactctggagagttgctacatcgtgatatcaagccc
tccaacctgctgctcaacagcgactgccaggtgaagcttgcagatttcggcctggcgcgc
agcgttagccagctaaatgcaagcgatggccagaaccctatccttaccgattacgtggct
acccggtggtatcgggcaccggaaatcctgctcggctccaccaagtacactttcggggtg
gacatgtggtctagcggttgcatcctgggtgagctgctgctgggcaagccaatctttcca
ggcacctcgaccatgaatcagctagaccgcatcgtggaattctgtggccggccggcacca
gcggacgtggaggccattgactccccatttgccactactatgatggattcgtgtaccgtc
acggcctctcgccgtctcgcagacatattccccaatgcaagtcccgaggcggccgatctc
ttgcggaagctacttgtttttaacccgcacaagcggctgacagcggagcaagctcttcgg
catccttacgtagcgcagttccacaatatggcggatgagccagtctgcaaccggatcatt
gtactgcctatttccgacaacactaagtacacagtatccgagtacaggtaa

DBGET integrated database retrieval system