KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_81513Help
Entry
VOLCADRAFT_81513  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00340  Histidine metabolism
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    VOLCADRAFT_81513
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     VOLCADRAFT_81513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 9615687
NCBI-ProteinID: XP_002951603
JGI: 81513
UniProt: D8TYL0
Position
Unknown
AA seq 432 aa AA seqDB search
MEAPTTLRTYQYSQLSPVEMKQVLARPRVDFTSILNTVAPIVENVRTNGDDAVREYTAKF
DRVQLDTVCVRIEELPDPVLPAEVTAAFDVAYNNIRAFHQAQQTPAMEVETMPGVRCRRV
TRPINSVGVYVPGGTAVLPSSALMLSVPAALAGCGTIVLATPPRPDGTITPEVLYCAKKA
GVTHILKAGGAQAVAAMAWGTASCPKVDKILGPGNQYVTAAKMLLQNSEAMVSIDMPAGP
SEVLVIADSGASPAHVAADLLSQAEHGPDSQVVLVALPGVDLAAVAAEVDRQCSALPRND
TARKALSHSYAVCSRDEAIRFSNMYAPEHLIVNVEDAEDWLPGLDNAGSVFLGRWTPESV
GDYASGTNHVLPTYGYARMYSGVSLDSFQKKMTVQNLSYEGLANLGPSVAKMAEVEGLEA
HRRAVTLRLGMQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgcccacaacgctgcgcacatatcagtacagtcagctttctcctgtggagatg
aagcaagtgttagcaaggcctcgggttgacttcacgtccatactcaacacggtggcccca
atcgttgaaaatgtccgcacaaacggtgacgatgccgttcgggaatacacagcgaagttt
gatcgcgttcagcttgatacagtatgcgtgcggattgaggagcttcccgaccctgtactc
ccggctgaggtgacggccgccttcgacgttgcctacaacaatattagggcattccatcag
gcgcagcaaacaccggccatggaggtggagacgatgcctggagtccgctgcaggcgggtg
acccggcccatcaactcagtgggtgtgtatgtgcccggtggcactgctgtactgcccagc
tccgcactcatgttgtcagtgccggcggcgttggccggttgcgggacgattgtgctggcc
accccgccacggccggacggcaccatcaccccggaggtgctgtactgcgccaagaaggcg
ggcgtgacccacatcctgaaagcgggcggagcgcaggctgtagccgccatggcctggggc
actgcctcatgtcccaaagtggacaagatcctgggccccggcaaccagtacgtcaccgcc
gcgaagatgctgctgcagaactcggaggccatggtttccatcgacatgcccgcgggcccc
tccgaggtcctggtgatcgcggactccggggcctcccccgctcatgtggcagctgacctg
ctgtcgcaggcggagcatggaccggacagccaggtggtgctggtggccctccccggagtg
gacctggcggctgtggctgccgaggtggaccgccagtgctccgccctgccacgtaacgat
acggcacgtaaggccctcagccacagctatgccgtatgttcccgggacgaggccattcgg
ttctccaacatgtacgccccggagcacctcattgtgaatgtggaggacgcggaggactgg
ctgccgggactggataatgcaggctcggttttcctgggccgctggacgccagagtccgtg
ggtgactacgcctccggaaccaaccacgtgctgccgacgtacggatacgcgcgcatgtac
agcggtgtgtcgttggactcgttccagaagaagatgacggtgcagaacttgtcgtacgag
ggtcttgcgaacctcgggcccagcgtcgccaagatggctgaggtggaggggttggaggct
caccggcgggcggtgactttgcggctgggcatgcagtga

DBGET integrated database retrieval system