KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_81547Help
Entry
VOLCADRAFT_81547  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    VOLCADRAFT_81547
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     VOLCADRAFT_81547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 254 aa AA seqDB search
MLARGLSHSARFSHSSKKRFNFTTRVRASHSTMALNYPRPIEINPSGPHTSTFIMLHGLG
DTGDGWSDIGYMYKASLPGTKFIFPHAPRRPITLNFGMSMPGWYDIASLEDIQGGEDGAG
LRESQRYVEELIQREIAAGIPSTKIVIGGFSQGGAVALMMLRSSIQLGGVVALSAYVPLH
KEQPLVSEANSKTPIFMCHGDADQTVAFEFGRRSYQMLLSLDANVEFQTYLGMAHSACQR
EFDDVLAFVKPILV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcgcgaggcctgtcgcattcagccaggttctcgcattcatctaagaagcgtttt
aattttacaactcgtgtgcgtgcatcccattccacgatggcgctaaactatccaaggccc
attgagattaatccatcagggccacatactagcactttcatcatgctacatgggcttggc
gatactggtgatggatggagcgatataggatacatgtacaaggcatctcttccaggaacc
aagttcatctttccacatgcgccacggcgcccgattactctcaactttggcatgagcatg
cccggctggtacgatatcgcatccctggaggacatccagggcggcgaagacggggccggg
ctcagggaaagccaacgatacgtggaggagctgatccaaagggaaatcgcggcggggata
ccctccaccaagatagtgatcggcggcttttctcagggcggcgcggtggcgctcatgatg
ttgcggtccagcattcagctgggcggggttgtcgcgctgagcgcctacgtgccactgcac
aaggagcagcccctggtttcggaggccaactccaagacacccatcttcatgtgccacgga
gatgcggaccagacagtcgccttcgagttcgggcgtcggagctaccagatgttgctcagc
ctggatgccaacgtggagttccagacttacctgggaatggcgcactcggcgtgccagcga
gaatttgatgatgtgctggcgttcgtcaagccaattttggtttaa

DBGET integrated database retrieval system