KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_81632Help
Entry
VOLCADRAFT_81632  CDS       T01330                                 

Gene name
ogd2
Definition
2-oxoglutarate dehydrogenase, E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VOLCADRAFT_81632 (ogd2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VOLCADRAFT_81632 (ogd2)
  Amino acid metabolism
   00310 Lysine degradation
    VOLCADRAFT_81632 (ogd2)
Enzymes [BR:vcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VOLCADRAFT_81632 (ogd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 448 aa AA seqDB search
MALRALRRAAGQLGSSLVQAQRAAGVVTAVELGPCCAEVLARQSSSQTSSNNVREELSSF
NAAARFRGISTQLRGLRTSAFGLEAFEVKVPPMGESITEGTIATLLKKPGDAVKEDDIIA
QIETDKVTIDVKYTGKAPGVVSQVLINPSDLVKVGQQVAVVETGAAPAAAPAAAAAPPPP
PKPAAEAPKPPPAPAAPKQGPVQPAFSSVAAPMPTSRPERRVKMTRLRMRVAERLKGAQN
TYAMLSTFNEIDMSGTIELRNTYKDAFVEKHNVKLGFMSVFVKAAAYALQEVPAVNAVIE
GDEIVFRDYYDISIAVATPKGLVVPVLRAADELSFADVEKTINLLGKKARDGTIGIDDMA
GGTFTISNGGVYGSLLSTPIINPPQSAILGMHAIIDRPVAVKGKVEIRPIMNVALTYDHR
LIDGREAVTFLRRIKDVVEDPRRLLLDI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcgtgcgctgcgccgcgcagcgggacaacttggaagtagcttggtccaggcg
caacgggccgccggtgtcgttaccgctgtcgagctggggccatgttgcgcagaggtcctg
gcgcgtcaatcaagcagccaaaccagtagtaacaatgtccgggaggaattatcttcgttc
aacgcagcggcacggttccgtggaatcagtacccaacttcgcgggcttcggacctcggca
ttcgggcttgaagcttttgaagtgaaagttccgcccatgggggaatcaattacggaaggt
accattgcgacgttgttgaagaaaccaggggacgctgtcaaggaggacgatatcattgct
cagattgaaaccgacaaggtcaccattgacgtgaaatatacgggcaaggcccctggcgtg
gtcagccaggtgctcattaatccttccgacctggtcaaggtcggtcagcaggtcgcggtc
gtggagacgggggcagcgccggcggccgcaccagcggcagcggcggctccaccgccgccg
cccaagcccgctgcagaggctccgaagcccccacccgcgccagcggccccaaaacagggt
cctgtgcagcccgcgttcagctcggtggccgcacccatgcccacgtcacgtcctgagagg
cgtgttaagatgacccggttgcgtatgcgtgttgctgagcggctcaagggcgctcagaac
acgtacgccatgttgtccaccttcaacgaaatcgacatgagcggcaccatcgagctgagg
aacacgtacaaggacgcgtttgtcgaaaagcacaacgtcaagttggggttcatgtcggtg
ttcgtgaaggccgcggcgtatgccctgcaggaagttcccgctgtgaatgcagtcatcgag
ggcgatgagatcgtgtttcgggactattacgatatctccatcgctgttgcgacacccaag
ggcttggtggttccggttctccgtgccgccgacgagctcagcttcgcagacgttgagaag
accatcaacctgttgggcaaaaaggcccgcgatggcaccatcggcattgacgacatggct
ggcggcaccttcaccatctccaacgggggcgtgtacggcagccttctgtccacacctatc
atcaacccaccgcagagcgctatcctgggtatgcacgccatcatcgaccgacccgtggcg
gtgaagggcaaggtggagattcggcccattatgaatgtcgccctcacgtacgaccaccgt
ctcatcgacgggcgggaggcggtcaccttcctgcgccggatcaaggatgtggtagaggac
cctcgccgcttgctgctggacatctag

  All links  
No link information was found.   
DBGET integrated database retrieval system