KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_82431Help
Entry
VOLCADRAFT_82431  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VOLCADRAFT_82431
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     VOLCADRAFT_82431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 456 aa AA seqDB search
MQATQQPNMRATRGAGAQFSRPCRARLIVRAKEGALPPPAWPQRVVPPEVEHRSEPKRFS
VLGSTGSIGTQTLDIIAEFPEKFKLVALAAGSNVQLLADQVRKFKPEMVAIRDASKIPEL
KEAIKDVHPQPVILAGDEGAVEVARHPAAESVVTGIVGCAGLLPTVAAIKAKKDICLANK
ETLIAGGPFILPLAQEYGAKILPADSEHSAIFQVMQGLPEGGLRRIILTASGGAFRDWPL
EKLKEVTVAQATSHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGVDYDNIDIVIHPQSI
IHSMIETQDSSVLAQLGWPDMRLPIMYTMSWPERVPVSDATWPRLDFTKASSLTFKAPDR
LKYPSMDLAYAAGRAGGTMTGVLSAANEQAVQMFIDEKVHYLDIMKLNEACCEAHKSELV
ASPDLETIVHYDAWARRWVADKVASGSFSSKVFAMA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctacgcagcagccgaatatgcgggcgacaaggggcgctggggcccagttctcg
cgcccgtgcagggcccgcttgattgttcgtgcgaaggaaggtgccctgccccctcccgcg
tggccgcagcgtgttgtgccgcctgaggtcgagcaccgcagcgagccaaagcgcttctca
gtcctgggctcgacgggttccatcggcacccaaacgctggacatcatcgctgagttcccc
gagaagttcaagcttgttgcgctagccgctggatccaacgtccagctgcttgcagatcag
gtccgtaaattcaagccggagatggtggccattcgcgacgcctccaaaattcccgagctg
aaggaggccatcaaggacgtgcatccccagccggtcatcctggctggtgatgagggggcg
gtggaggtggctaggcaccctgccgcggagtccgtggtgaccggcattgtggggtgtgcg
ggactgctgcccacggttgccgccataaaggccaagaaggacatttgcctggcaaacaag
gagaccctgattgccggcggtcccttcatcctgccattggcccaggagtacggcgccaag
atcttgccggcggatagcgaacacagcgccatctttcaggttatgcagggcctgccggag
gggggtctgcgccgcatcatcctgacggccagtggaggcgccttccgggactggcccctg
gagaagctcaaggaggtgacggtggctcaggccaccagccaccccaactggtccatgggc
aagaagatcacagtggacagcgccacgctcatgaacaagggtttggaggtcatcgaggcc
cactacctgttcggcgtggattacgacaacatcgacatcgtcatccacccccagtcgatc
atccactccatgattgagacacaggactcctcggtactggcccagctgggctggcccgac
atgcgcctgccgatcatgtacaccatgagctggccggagcgagtgccagttagcgacgcc
acctggccccgactggacttcaccaaggcctcctccctcaccttcaaggcccccgaccgc
ctcaagtacccctccatggacctggcctacgcggcaggacgtgcggggggcaccatgact
ggggtgctatcagcagccaatgagcaggcagtacagatgttcattgacgagaaggtgcac
tatctggacatcatgaagctcaacgaggcctgctgcgaggcgcacaagtctgagctggtc
gcctcacccgacctggagaccatcgtgcactacgacgcctgggcccgccggtgggtggcg
gacaaggtggccagcgggtcgttcagctccaaggtcttcgccatggcgtga

DBGET integrated database retrieval system