KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_83090Help
Entry
VOLCADRAFT_83090  CDS       T01330                                 

Definition
MGDG specific palmitate delta-7 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VOLCADRAFT_83090
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    VOLCADRAFT_83090
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     VOLCADRAFT_83090
Lipid biosynthesis proteins [BR:vcn01004]
 Desaturase
  First
   VOLCADRAFT_83090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 308 aa AA seqDB search
MAQADEPGAGHVPFSDVYTVPKRNLFGRDWNGTDLYYTAFIGGMHLLALAAPFTFSWDMV
ALFFGSYFVTGCLGITLSYHRQLSHKSFTTPKWLEYILAYCGVLAVQGDPLEWASSHRYH
HLHTDTPLDPHSPYEGFFWSHMGWLLDNRATMERVSNRSNADDLESQWYYRFLRDTYGWH
VAAQLAVLFLAGGLPAVVWGGALRMVWVWHITWFVNSASHCWGYQDYDTGDLSKNNWWVG
ILAFGEGWHNNHHAFEFSARHGFEWWQVDMTWGMVCLLEKLGLASNIKLPTERQKARLAI
KRPAAGAA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggcagatgagcccggtgcggggcatgtgccattctccgacgtctatactgtc
ccgaagcgcaacctttttggccgcgactggaacggaacggatttgtactacactgccttt
atcggcggaatgcacctgctcgcgctggcggcgcctttcacgttctcttgggatatggtg
gcgctgtttttcgggtcgtactttgtgaccggctgcctgggcattactctgtcgtaccac
cggcagctgagccacaagtccttcacaacgcccaagtggctcgagtacatcttggcgtac
tgcggagtgctggccgtacagggcgaccctttggaatgggccagcagtcatcgctaccac
cacctccataccgacactcctctggatccacactcgccgtacgagggcttcttctggagt
cacatgggctggctgctggacaaccgggccacgatggagcgagtttccaaccgcagcaac
gccgatgacctggagtcccagtggtattaccgcttcctgcgtgacacgtatgggtggcat
gtggcagcccagttggcggttctattcctggcgggcggcttgccggccgttgtttggggc
ggagcgctgcgcatggtttgggtgtggcatatcacttggttcgtaaactcggcgtcgcac
tgctgggggtatcaggactacgacacgggcgatctgtccaagaacaactggtgggtgggt
atcctggcttttggcgagggctggcacaacaaccaccacgccttcgagttctcagctcgc
cacggcttcgagtggtggcaggtggacatgacatggggtatggtttgcctcctggagaag
ctggggctcgcgagcaacatcaaactgcccaccgagcgacaaaaggcccgcctggcgatc
aagaggcccgccgctggcgccgcctaa

DBGET integrated database retrieval system