KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_83109Help
Entry
VOLCADRAFT_83109  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VOLCADRAFT_83109
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     VOLCADRAFT_83109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 565 aa AA seqDB search
MLTSHATNIYANSKARLQIREIARPTVTGVSRSGVLQDVASPLPRQIPRPAQRAARPTSA
TATSSGVPTADSARGTKIVDNVYDVIVVGGGLSGLVTGQALSAQHGVNNFLVTEARERVG
GNITSMSGDGYVWEEGPNSFQPNDSMLQVAVDAGVEKDLVLGDPKAPRFVYWQNKLRPVP
SGPDALTFDLMSLPGKIRAGLGAIGLINGAMPNFEESVEQFIRRNLGDEVFERLIEPFCS
GVYAGDPSKLSMKAAFNRIWILEKDGSSLVGGALKLFQERRKNPPPPRDPRLPPKPKGQT
VGSFRLGLKMLPEAIERRIKDQVRVNWKLVSLTRDGDRYSLVYDTPEGRVQCYSRAVALT
APSYVVADLIKAEVPAAAEALSSFDYPPVGAVTLSYPLSAIRDDRKDAQGNVPGFGQLHP
RSQGVTTLGTIYSSSLFPGRAPPGHMLLLNYIGGATNRGIVNQTQEQLVAQVDKDLRLMV
LKPDAPAPRVVGVRVWPRAIPQFNIGHLELLDKARGALEAKGWNGVFLGGNYVSGVALGK
VVEYGYESAAKLAKHLTAAQKQVAV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgctgactagccatgccactaacatctacgcgaactcaaaggccaggcttcagatccgc
gagatcgctcggccgacggtgaccggtgtctcgaggtcaggcgttcttcaggatgtcgcc
tctccgctcccacggcagattccgaggccagctcaacgtgctgcgcgtcctacttctgct
acggccacttcaagtggggtacccacggcggacagtgcccgtggcacgaagatcgttgac
aatgtgtatgacgtgattgtggttggcggtggcctctccgggctcgttacgggtcaagcc
ctctcggcgcaacatggtgttaataacttcctcgttaccgaggctcgcgagcgcgtcggc
ggcaacattacgtccatgtcgggcgatggctacgtgtgggaggaaggcccaaacagcttc
cagccaaatgatagtatgttacaagtagctgtggatgccggggtggagaaggacctggtg
ttgggagaccccaaggcaccccgatttgtgtactggcagaacaagctccgtcccgtcccc
agcggccctgatgcgctcacctttgacctcatgtcccttccggggaagatccgagctggt
ctcggagccattggcctgatcaacggagccatgcctaactttgaggagagcgtggagcag
ttcatccgtcggaacctgggtgacgaggtgttcgagcgcctcattgagccgttctgctcg
ggggtgtacgcgggagatccatccaagctatccatgaaggcagcgtttaacaggatctgg
attttggagaaggacggcagcagtctggtggggggtgcgttgaagctgtttcaggagcgc
cgcaagaacccgccgccacctcgcgatccccgcctgccgcctaaacccaagggccaaacg
gtgggttctttccgtctcggtctcaagatgttgcccgaggcgattgagcggcgtatcaag
gaccaagtcagggtcaactggaagctggtgtcgttgacgcgcgacggcgatcgctacagc
ctggtgtacgacacgccggagggccgagtgcaatgctacagccgtgcggtggcgctgacg
gcaccgtcgtatgttgtggcggatcttatcaaggctgaggtgccagccgctgcggaggct
ctgtcctcgttcgactaccccccggtgggggccgtcactctgagctaccccctgtcagcc
atacgggatgatcggaaggacgcgcagggcaacgtgccgggtttcggacagctccacccc
cgctcgcagggcgtgacgactctgggcaccatctacagctcctccctgttcccgggtcgg
gctcccccggggcacatgctgctgctcaactacatcggaggggccacgaaccgagggata
gtcaaccagacgcaagagcagcttgtggcgcaggtggacaaggacttgcggttgatggtg
ctcaagcccgacgcgccggctccacgtgtggtgggcgtgcgggtttggccccgtgccatt
ccccagttcaacatcgggcacttggagctgctggataaggcccggggggcgctggaggcc
aagggctggaatggcgtcttccttggcgggaactacgtctcgggggttgccttgggcaag
gtggtggagtacgggtacgagagcgcggccaaacttgcaaagcacctcacagccgctcag
aagcaggtggcggtgtaa

DBGET integrated database retrieval system