KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_83180Help
Entry
VOLCADRAFT_83180  CDS       T01330                                 

Gene name
glgb7
Definition
1,4-alpha-glucan branching enzyme II
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vcn00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 824 aa AA seqDB search
MWLSATQRCTGYPRRCLALDHHHNHHDILPGSAGRPSVRFANRKPFHPAFQRATSPIFAT
TAAAVDGIAKEKDEEGLAVVAVDPQLANYADHFRYRWAQYRNTLERIEAAEGSLEQFARG
YEYFGFHREQPQEGGGAGAGAGGALMYREWAPAAQAAALVGDFSSWQPVWMTRDQWGVWS
VRLPDVDGRPAIPHGSRVKVRLQHPGGGWVDRIPAWIRWAVAEKRMGAGYDGMYWSPPAG
ERYEFRHPRPPRPPALRIYEAHVGMSSEEPKVASYTEFKDTVLPRIQALGYNAIQLMAVQ
EHAYYGSFGYHVTNPFAVSSRSGTPEELKALIDEAHRRGLLVLLDVVHSHISKNQEDGLA
GFDLGQKEEDNYFKQGEAGYHKLWDSRCLNYANFETLRYLLSNLSWWIEEYHFDGFRFDG
VTSMLYHHHGIYTSFSGSYHDYLGPGTNVEAVVYLMLANQLVHQLLPQAVTVAEDVSGMP
ALCRPVAEGGVGFDARLNMSIPDKWIQLLKHTRDEDWRMHDIVTALCNRRYTESSIGYAE
SHDQALVGDQTVAFRLMGAEMYGGMSALTEPSEVVARGVALHKMIRLVTLALGGEGWLNF
MGNEFGHPEWIDFPRDGNGWSHHYCRRQWSLADTSHLRYKFLQAWDAAMMRLDEHYGILS
SRHQWVTHMDERQQARRVLVFERGPLVFVFNWSPFSSFEGYRVAVPCPGKWRVALDSDAW
DFGGEGRVGHDMDHFSDPEPAGTSRDRQHSIRVLAPSRTAVVYYNADTHTHWQQPQQQED
RQEEGEEGQGGNSGQRLLLGLTPPATQTAGGLSLGSGDEQSGLL
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgtggctatcggccactcagcgctgcacaggatatccacgtcgatgcttagcactagat
catcatcataatcatcatgacattctaccaggcagcgccgggcgcccgtcggttcgcttt
gccaatcggaagccctttcatccggctttccaacgggccacatcgccgatcttcgcaacc
actgccgctgctgtggacggtatcgctaaggaaaaggacgaggagggtcttgcggtagtg
gcggtggatccgcagctcgccaattatgcggaccactttcgatacagatgggcccaatac
cggaacaccctggagcgcatagaagcggccgaaggttccctggagcagtttgctcggggg
tatgagtactttggcttccacagggaacagccccaggagggtgggggggcgggggcgggg
gcggggggtgcattgatgtacagggagtgggccccggcggcccaggcggcggcgctggtg
ggggacttcagctcctggcagcccgtgtggatgacccgggaccagtggggtgtgtggagt
gtacgattgccggacgtcgatgggcgccccgccatcccccacggctcccgagtcaaggtg
cggctgcagcacccggggggtgggtgggtggaccgcatacccgcctggattcgctgggcg
gtggcggagaagcgaatgggcgctgggtacgatggaatgtattggtctccccctgccggt
gagcgttacgagttccgccacccccggcccccccggccccccgcactgcgaatttatgag
gcccacgtgggcatgagcagcgaggagcccaaagtggcgtcatacaccgagtttaaggac
acggtcctgccccgaatccaggctctgggctataacgcgatccagctgatggccgtacaa
gagcacgcgtactacgggtcatttggatatcatgtgacaaaccccttcgcggtcagcagc
cgcagcggcacccccgaggaactcaaggccctgatagacgaggctcaccggcgcggcctc
ctggtactgctcgacgtggtccactcccacatctccaagaaccaggaggacggcctcgcc
gggttcgacctggggcagaaggaggaggacaactacttcaaacagggggaggctggctac
cacaagctatgggatagccgctgcctaaactacgccaactttgagaccctccgttacctg
ctctccaacctgagctggtggattgaggagtaccacttcgacgggttcaggttcgatggg
gtgacctccatgctgtatcaccaccacggcatctacacctccttctccgggtcctatcac
gactacctgggccccggcaccaatgtggaggcggtggtgtacctgatgctggccaaccag
ctggtgcaccagcttctgccgcaggcagtcaccgtcgcggaggacgtgtcgggtatgcca
gccctgtgccgccccgtggctgagggaggtgtgggcttcgacgcgcgactgaacatgtcc
attcccgacaaatggatacagctgctcaaacacacacgggacgaggactggcgcatgcac
gacatagtcacggctctgtgtaacaggcgttacaccgagagcagcatcggatacgcggag
agccatgaccaagcgctggtgggcgaccagacggtggcattccggttgatgggtgcggag
atgtacggcggtatgagcgccctcacggagccgagtgaggtggtggccaggggggtggcg
ctgcacaagatgatacggctcgtcacactggcgctggggggcgagggctggctcaacttc
atgggcaatgagttcggtcaccccgagtggatcgacttcccccgcgacggcaacggctgg
agccaccactactgccgccggcagtggtcgctggcggacacgtcccacctgcggtacaag
ttcttgcaggcctgggatgccgccatgatgcgactggacgagcattacggcatcctgtca
tcccgccaccaatgggtgacgcacatggacgagcggcaacaggcaaggcgggtcctggtg
ttcgagaggggccccctggtgttcgtgttcaactggagccccttctccagctttgagggc
taccgagtggcagtgccgtgcccggggaagtggcgggtggcactggactcggatgcgtgg
gacttcggaggagagggcagggtgggtcatgatatggaccacttttcagatccggagccc
gcgggaaccagccgggaccgccagcactccattcgggtcctggcaccctcccgtactgcc
gtggtgtactacaacgccgacacgcacactcactggcagcagccgcagcagcaggaggat
agacaggaggagggcgaagaagggcagggtggtaacagcggccagcggttgctactcggt
ctgacccctccggccactcagaccgcagggggcctcagtctgggcagtggtgacgagcaa
tcagggctcctgtga

DBGET integrated database retrieval system