KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_83997Help
Entry
VOLCADRAFT_83997  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
vcn  Volvox carteri f. nagariensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 240 aa AA seqDB search
MSNAKKWVPLESNPDVLNEFVSKLGLDVSEHSFSDVFGLDEELLEMVPKPVIAVILCYPV
TSESDALAKKEDEEQAAKGMPVDAKLFYMKQTIGNACGTIAVLHSIGNNLSTMDPADGSF
LQQFFSATSGMSAAEAGKYLEEPPSGAPSIEEAHQAAAAAGDTAPPSADEDVDLHFVAFV
HKDGQLWELDGRRAGPVCRGPSSSETLLQDAARVVQDFISRSSSLTFNVLALTATAGGGA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatgccaagaaatgggtgccgctcgagagcaatccagatgtcctgaacgaattc
gtttccaagcttggccttgatgtatctgaacactctttctcagatgtctttggactggat
gaggaacttctggaaatggtaccgaagccagttatcgctgtaatattgtgctatcccgta
acttctgaaagtgatgctttggctaaaaaagaggatgaagagcaggcggctaaagggatg
ccggtcgacgcaaagctcttctacatgaagcagactatcggcaacgcgtgcggcacaatt
gcggttctgcattctattggcaacaacttgagcactatggaccccgcggatggcagcttc
cttcagcagttcttttccgcaacgtccggaatgtccgcggcggaagctggcaagtacttg
gaggaacccccttcaggcgcacccagcattgaggaggcacaccaggctgctgctgcagcg
ggcgacaccgcaccaccatccgccgacgaagatgtggacctgcacttcgtcgccttcgtg
cacaaggacggccagctgtgggagctggacggccgcagggcaggaccggtgtgccggggg
cccagcagttcggagacgctgctacaggacgcggcccgagtggtgcaggacttcattagc
aggagcagtagccttacgttcaacgtgttggcgctgactgcaactgccggcggtggggct
tag

DBGET integrated database retrieval system