KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_84225Help
Entry
VOLCADRAFT_84225  CDS       T01330                                 

Gene name
apx3
Definition
L-ascorbate peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VOLCADRAFT_84225 (apx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 377 aa AA seqDB search
MATSAPRMLRLGSLLARQAAPSSLLQQQFRTFSDNAAAEAAKAAPEAVKADSGSKGKIRG
VQALIFGGLGAGMLYGYSLFTSQPPPSGPLAGPPTLPTGTAPKTSTPGDYAAVRDSISSL
LEAADYDDGSYGPLLVRLAWHASGTYDKSSCTGGSNGATMRFPPECEWAANRGLAIARQL
LEPVKAAHPWISYADLWTLAGVVAIEDMGGPSVAWRPGREDYSDGSKIVPDGRLPNATLG
AKHLRDIFHRMGFDDRDIVALSGAHTLGRCHPDRSGFSGPWTNAPTTFSNLYFQELVNNK
WRPKKWDGPLQYEDAKTGTLMMLPTDLALLSDRTFKKYVAQYAKDEEAFFKDFAVAFGKL
LELGVPFPSAEKAAATS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctacgtcggccccacgcatgctgcggttgggatcgttgcttgcccggcaggcggct
ccctcatcccttctgcagcagcagttccggacgttttccgacaatgccgctgcggaggca
gccaaagcagctccagaggctgttaaggcagactcagggtcgaagggcaagattcgggga
gtccaggcgctgatttttggcggtctaggcgctggcatgttgtacgggtactcgcttttc
acgtcgcagcctcctccatctggacccctggccgggcctccaacgctgcccaccgggact
gccccgaagacttcgactccgggtgactacgctgcggttcgtgattccatctcttccctc
ctagaagctgcggattatgacgacggttcatacggcccgctgctggtacggcttgcttgg
cacgcatctggcacgtacgacaagagtagttgcaccggcggctccaacggcgcgaccatg
aggttccctcccgaatgcgagtgggctgccaatcgcggtctggccattgcccgccagctg
ttggagccggtgaaggcggcccacccctggatcagctacgcggacttgtggacgctggcg
ggagtagtggccatcgaggacatggggggtccctcggtggcatggcgaccaggccgggag
gactactcggacggatccaagattgtgccggatggccgactgccgaatgcgactctgggc
gccaagcacctccgggacattttccaccgcatggggtttgacgaccgggacattgtggcc
ctcagcggggcgcatacgctgggtcgctgccacccggaccgcagcggtttctccgggcct
tggaccaacgcccccaccaccttctccaacctgtacttccaggagctcgtcaacaacaaa
tggcgccctaagaagtgggacggtcctctgcagtacgaggacgccaagaccggcaccctg
atgatgctgcccactgacctggccttgctgtcggacaggaccttcaagaaatacgtcgct
cagtacgccaaggatgaagaggcgtttttcaaggactttgccgtggcgtttggcaagctg
ctggagctgggagtaccgttcccttcggcggagaaggcggccgccacgtcttag

DBGET integrated database retrieval system