KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_84268Help
Entry
VOLCADRAFT_84268  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     VOLCADRAFT_84268
Peptidases [BR:vcn01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   VOLCADRAFT_84268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 316 aa AA seqDB search
MEWTTIESDPGVFTELIAQIGVKGVQVEELWSLDQLKELSPVFGLIFLFKWRKEAGKRQT
TPGGAQGVFFARQVITNACATQAILSILLNCPGLDLGTELSNFREFVADFDPNMKGLAIS
NSDLIRTVHNSFARPEPLVPEEDKDEEKGGEAYHFISYVPIGGKLYELDGLQEGPIELCE
CTTSDWLDRVGPHIAERMERYAASEIRFNLMALVGNRVELYGSRLAAVAARREELAAAVA
AAAASVRVKVGLQVQLLETETEVANLQEALAAEEAKHRAWHDENVRRRHNYVPFLFHLLK
LMAARGELGPLLERAR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaatggacaacaattgaatctgaccctggggtttttacggagctcatcgcgcagatt
ggcgtgaagggcgtccaggtggaagagctgtggtcgttggaccagctgaaggagctcagt
cccgtgtttggtttgatcttcctgttcaagtggaggaaggaggcgggaaagcggcagacg
actccagggggggcacagggggtgttcttcgcccggcaggtcatcacgaacgcctgcgct
acgcaggccattctgtccatcctgctgaactgcccgggtctggatctgggcactgagctg
tccaacttccgcgagttcgtggcggatttcgaccccaatatgaaaggtcttgccatcagc
aacagcgacctcatccgcacagtacacaacagctttgctcgtccggagcccttggttccg
gaggaggacaaggacgaggagaagggcggggaggcgtaccacttcattagctacgttccc
atcggggggaagctgtacgagttggacggactccaggagggccctatagagctgtgcgag
tgtacgacgtctgattggttggaccgggtggggccccacatcgcggaacggatggagagg
tacgcagccagcgagatcaggttcaacctcatggcgctagtgggaaacagggtggagctg
tacggcagcagactggcggcggtggcggcgcggcgggaagagctggcggcggcggtggcg
gcggcggcggcatcggtgagggtaaaggtcgggctccaggtccaactgctggagactgag
accgaggtggccaacctgcaggaagctctggcggccgaggaagccaagcaccgcgcctgg
cacgacgaaaacgtacggcgcagacacaactacgtgcccttccttttccatctgctcaag
ctgatggcggcccgcggcgagttgggaccgctgctggagcgggcgcgatga

DBGET integrated database retrieval system