KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_84379Help
Entry
VOLCADRAFT_84379  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vcn01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:vcn00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 348 aa AA seqDB search
MIYHQAEKMFCRETFILFLFGFACTAAIRTLGPGQLKLDLDDGMTPELLQPLNYVSGSLP
VVLWHGMGDSCCSPFSIGAVAKLIEAKLGVFVHSVNTGSTEFSDVLSGFWGDVNDQVALV
CAQLRNLTQLKGGYNAVGFSQGGQFLRAVAERCQHTGGPLMRTLVTMGAQHQGVMNVPGC
RTLPLNSSHGACYLMQKMLGEGAYLPYIRDHVVQAQYFKDPLRLSEYLVANPFLPDINNE
RGPEGRNPLYGNNLASLERLVLYRFSDDDTVVPRDSAWFSFFDGQRLVPLYDQPLYKEDW
IGLRSLDERGQLVLEEAPGAHMQFTLQWFADNVIRKYLYPNPEVSESQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatataccaccaagccgaaaaaatgttttgcagagagacattcatactctttctattc
ggtttcgcatgcactgctgctatccggacgctcggtcctggacagctgaagcttgaccta
gatgacgggatgactcctgagctgctgcaacccttgaattatgtatccggaagcctgccg
gttgtgttgtggcatggcatgggagattcgtgctgttcaccgtttagtatcggagcagtg
gccaagctgattgaagccaaactcggtgtcttcgtgcacagcgtcaacaccggaagcacg
gagttcagcgatgtcctcagcggcttttggggagacgtcaacgaccaggtggcattagtt
tgtgcacagctccgaaacctcactcagctcaaaggcggatataacgcggtgggcttctca
cagggcggccagttccttcgggctgttgctgagcggtgtcagcacacggggggccccctc
atgaggacgttggtgacaatgggagcgcagcaccaaggggtgatgaacgtgccgggatgc
aggacactgccgctcaattctagccacggcgcttgctacctgatgcagaagatgctgggc
gaaggcgcatacctgccgtacattcgtgatcatgtcgtacaggcgcagtactttaaggac
ccgctgcggctttctgagtatctcgtcgcgaaccccttcttgccggatatcaacaacgaa
cgaggaccagagggacgaaacccactgtacggcaacaaccttgcatcgttggaacgcctg
gtgctataccgcttttctgacgatgacaccgtggttcctcgggacagtgcttggttctcg
ttcttcgacggtcagaggctcgtaccattgtacgaccaaccgctgtacaaggaggattgg
attgggctacggtctttggacgagcgcggacagctggtgctcgaggaagcccctggcgcg
catatgcagttcacgttacagtggtttgccgacaacgtaatccggaagtatctatatccc
aatccggaagtatctgaatcccaatga

DBGET integrated database retrieval system