KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_84379Help
Entry
VOLCADRAFT_84379  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VOLCADRAFT_84379
  Lipid metabolism
   00062 Fatty acid elongation
    VOLCADRAFT_84379
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     VOLCADRAFT_84379
Lipid biosynthesis proteins [BR:vcn01004]
 Fatty acid synthase
  Component type
   VOLCADRAFT_84379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 348 aa AA seqDB search
MIYHQAEKMFCRETFILFLFGFACTAAIRTLGPGQLKLDLDDGMTPELLQPLNYVSGSLP
VVLWHGMGDSCCSPFSIGAVAKLIEAKLGVFVHSVNTGSTEFSDVLSGFWGDVNDQVALV
CAQLRNLTQLKGGYNAVGFSQGGQFLRAVAERCQHTGGPLMRTLVTMGAQHQGVMNVPGC
RTLPLNSSHGACYLMQKMLGEGAYLPYIRDHVVQAQYFKDPLRLSEYLVANPFLPDINNE
RGPEGRNPLYGNNLASLERLVLYRFSDDDTVVPRDSAWFSFFDGQRLVPLYDQPLYKEDW
IGLRSLDERGQLVLEEAPGAHMQFTLQWFADNVIRKYLYPNPEVSESQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatataccaccaagccgaaaaaatgttttgcagagagacattcatactctttctattc
ggtttcgcatgcactgctgctatccggacgctcggtcctggacagctgaagcttgaccta
gatgacgggatgactcctgagctgctgcaacccttgaattatgtatccggaagcctgccg
gttgtgttgtggcatggcatgggagattcgtgctgttcaccgtttagtatcggagcagtg
gccaagctgattgaagccaaactcggtgtcttcgtgcacagcgtcaacaccggaagcacg
gagttcagcgatgtcctcagcggcttttggggagacgtcaacgaccaggtggcattagtt
tgtgcacagctccgaaacctcactcagctcaaaggcggatataacgcggtgggcttctca
cagggcggccagttccttcgggctgttgctgagcggtgtcagcacacggggggccccctc
atgaggacgttggtgacaatgggagcgcagcaccaaggggtgatgaacgtgccgggatgc
aggacactgccgctcaattctagccacggcgcttgctacctgatgcagaagatgctgggc
gaaggcgcatacctgccgtacattcgtgatcatgtcgtacaggcgcagtactttaaggac
ccgctgcggctttctgagtatctcgtcgcgaaccccttcttgccggatatcaacaacgaa
cgaggaccagagggacgaaacccactgtacggcaacaaccttgcatcgttggaacgcctg
gtgctataccgcttttctgacgatgacaccgtggttcctcgggacagtgcttggttctcg
ttcttcgacggtcagaggctcgtaccattgtacgaccaaccgctgtacaaggaggattgg
attgggctacggtctttggacgagcgcggacagctggtgctcgaggaagcccctggcgcg
catatgcagttcacgttacagtggtttgccgacaacgtaatccggaagtatctatatccc
aatccggaagtatctgaatcccaatga

DBGET integrated database retrieval system