KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_87373Help
Entry
VOLCADRAFT_87373  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    VOLCADRAFT_87373
  Replication and repair
   03420 Nucleotide excision repair
    VOLCADRAFT_87373
Transcription machinery [BR:vcn03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     VOLCADRAFT_87373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 191 aa AA seqDB search
MDFTAYIANLSADKRTLLYRSPWTSLAVFRNLPPLAQVYVMRLLFVPTPFPADYLDSWAL
RSATSTHQAALAALRGLDVLLEQRIKPVTTVGPHAAGFGAVAGGRAASAAAAPQQQVHRA
VCVLHPDFRTQLQRVACCGSQLMRGDVPPAAAASAPSLEQLGEWATGQWEALQLYLLGAG
RSPPALPPLLR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggacttcacggcctacatcgccaatctcagtgccgacaagcgcacactgctgtaccgc
agcccctggacgagtctggccgtgttccgaaacctgccgccgttggcacaggtgtacgtc
atgcggctcctgttcgtaccgacgccctttccggcggattacctggactcctgggcccta
cgttccgccaccagcactcaccaggcggccttggcggctctcagggggctggacgtactg
ctggagcagcggataaaacccgtcaccaccgtggggccacatgcagccggtttcggagca
gtggccggcggcagagcggcctcagctgcagccgcccctcagcagcaggttcatcgagct
gtgtgtgtgctacacccggacttccgaactcagctgcagcgagtggcttgttgcggatcc
cagctgatgcgcggtgacgttccccccgccgccgccgcctctgccccctccctggagcag
ctgggcgagtgggccacggggcagtgggaggcgctgcagctctacctgctgggggcgggg
aggtctccgccggcattgccgccgctactgcgg

DBGET integrated database retrieval system