KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_87791Help
Entry
VOLCADRAFT_87791  CDS       T01330                                 

Gene name
kdg2
Definition
(RefSeq) diacylglycerol kinase
Organism
vcn  Volvox carteri f. nagariensis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 493 aa AA seqDB search
MKASQADPEEAQGSWSLNVRCGAATGTIHLKDDGMFSFTPDPTHGGGYHEQRRVANTQAN
CENKGRRTRRANARPHRSPIGWLFRLLRRPVQHQVIPADQLLGARLESPCTLTVWFATPH
TARMGCVTKHLFRVRQTPRFEASDPLAASELVARVRRAASWWGRDTPPHVAAIINPKAGR
GGAAGLFHGRLLPLLRDVAGLRVSERLTEAAGHASALVRELALNVAGGGVGGGGDGGDEG
GVGGGAGDVPAADGVDLIMFVGGDGTLHEGLQGLFQRPDWESARGIPLVAIPCGSGNGVA
ASCGLWDVPTAVVAVCRGQVAPVDVASVLQPPDNRYYCLLSVVYGAMLPCLPTRLPDSPS
SLPGGWQQLADSFAIFGAYNTQYVALGARANPGGLMADGAWEVWQLAAQGRRAGAGLRLR
SLKVLLGVEDGSFAKAAGVMHVTKARALLFQQRDDSTWTVLDGEAVREAPLYLEVHPRLC
RLLVSPVFREEPL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcttcacaggctgatcctgaggaagcccaaggctcctggtcgctgaacgtgcgc
tgcggtgctgctacggggaccatccatctgaaggacgatggcatgttttcatttacaccc
gatcctacccacggtggtggttaccacgaacaaagacgtgtagcaaacacacaggcaaac
tgcgaaaacaaaggtaggcgaactaggcgtgccaatgcacgtccacacaggagccccatc
ggttggctgttccgccttttgcgacgacctgtacaacaccaggtcatacccgccgatcag
ctgcttggggcccgccttgagtccccctgcacccttaccgtgtggttcgccaccccgcac
accgcccgcatgggctgcgtcacgaagcacctcttcagggttcgccaaacaccccggttc
gaggccagcgacccacttgccgcctcggagctggtcgcccgtgtccgccgagctgccagc
tggtggggtcgggacacgccaccccatgtggcagctatcataaaccccaaggccggtcgc
ggcggcgccgccgggctgttccacggccggttgctgccgctgctgcgcgacgtggcgggc
ttgcgggtttcggagcggctcacagaagcggcagggcatgcgagtgcgctggtgcgggag
ctggcgttgaacgtggcaggcggcggagtaggaggcggaggagatggaggagacgaagga
ggagtaggaggaggggcgggggatgtaccggcagcggacggtgtcgacctgattatgttt
gtgggcggtgacggcactctgcatgaggggctgcaggggcttttccagcgaccggattgg
gaatccgcccggggcatcccccttgtggccattccctgcggcagcggcaacggcgtggct
gctagctgcggtctgtgggatgttcccacggccgtcgtggcggtgtgccgcggacaggtc
gcaccggttgatgtcgcttcggtgctacagccgcccgacaaccggtactactgcctgtta
tcagtcgtgtacggcgcgatgctgccctgcctgcccactcgcctgccggactccccttcc
tcgctgccgggaggttggcagcagctcgctgactcattcgccatctttggcgcctacaac
acgcagtacgtggcgttaggtgcgcgggccaacccggggggccttatggctgatggcgcg
tgggaggtatggcagctggcggcgcagggccggcgtgctggcgcggggctgcgactgcgc
tccctaaaggtgcttctgggagtggaggacggcagctttgcgaaggcggctggcgtgatg
cacgtgaccaaggcccgagcgctgctgttccagcagcgcgacgattccacatggacagtg
ctggacggggaggcagtgcgggaggcgccgctgtacctggaggtgcatccgcggctgtgt
cggctgctggtttcgcccgtgtttagggaggagcccctttag

DBGET integrated database retrieval system