KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_87791Help
Entry
VOLCADRAFT_87791  CDS       T01330                                 

Gene name
kdg2
Definition
diacylglycerol kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    VOLCADRAFT_87791 (kdg2)
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     VOLCADRAFT_87791 (kdg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 493 aa AA seqDB search
MKASQADPEEAQGSWSLNVRCGAATGTIHLKDDGMFSFTPDPTHGGGYHEQRRVANTQAN
CENKGRRTRRANARPHRSPIGWLFRLLRRPVQHQVIPADQLLGARLESPCTLTVWFATPH
TARMGCVTKHLFRVRQTPRFEASDPLAASELVARVRRAASWWGRDTPPHVAAIINPKAGR
GGAAGLFHGRLLPLLRDVAGLRVSERLTEAAGHASALVRELALNVAGGGVGGGGDGGDEG
GVGGGAGDVPAADGVDLIMFVGGDGTLHEGLQGLFQRPDWESARGIPLVAIPCGSGNGVA
ASCGLWDVPTAVVAVCRGQVAPVDVASVLQPPDNRYYCLLSVVYGAMLPCLPTRLPDSPS
SLPGGWQQLADSFAIFGAYNTQYVALGARANPGGLMADGAWEVWQLAAQGRRAGAGLRLR
SLKVLLGVEDGSFAKAAGVMHVTKARALLFQQRDDSTWTVLDGEAVREAPLYLEVHPRLC
RLLVSPVFREEPL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcttcacaggctgatcctgaggaagcccaaggctcctggtcgctgaacgtgcgc
tgcggtgctgctacggggaccatccatctgaaggacgatggcatgttttcatttacaccc
gatcctacccacggtggtggttaccacgaacaaagacgtgtagcaaacacacaggcaaac
tgcgaaaacaaaggtaggcgaactaggcgtgccaatgcacgtccacacaggagccccatc
ggttggctgttccgccttttgcgacgacctgtacaacaccaggtcatacccgccgatcag
ctgcttggggcccgccttgagtccccctgcacccttaccgtgtggttcgccaccccgcac
accgcccgcatgggctgcgtcacgaagcacctcttcagggttcgccaaacaccccggttc
gaggccagcgacccacttgccgcctcggagctggtcgcccgtgtccgccgagctgccagc
tggtggggtcgggacacgccaccccatgtggcagctatcataaaccccaaggccggtcgc
ggcggcgccgccgggctgttccacggccggttgctgccgctgctgcgcgacgtggcgggc
ttgcgggtttcggagcggctcacagaagcggcagggcatgcgagtgcgctggtgcgggag
ctggcgttgaacgtggcaggcggcggagtaggaggcggaggagatggaggagacgaagga
ggagtaggaggaggggcgggggatgtaccggcagcggacggtgtcgacctgattatgttt
gtgggcggtgacggcactctgcatgaggggctgcaggggcttttccagcgaccggattgg
gaatccgcccggggcatcccccttgtggccattccctgcggcagcggcaacggcgtggct
gctagctgcggtctgtgggatgttcccacggccgtcgtggcggtgtgccgcggacaggtc
gcaccggttgatgtcgcttcggtgctacagccgcccgacaaccggtactactgcctgtta
tcagtcgtgtacggcgcgatgctgccctgcctgcccactcgcctgccggactccccttcc
tcgctgccgggaggttggcagcagctcgctgactcattcgccatctttggcgcctacaac
acgcagtacgtggcgttaggtgcgcgggccaacccggggggccttatggctgatggcgcg
tgggaggtatggcagctggcggcgcagggccggcgtgctggcgcggggctgcgactgcgc
tccctaaaggtgcttctgggagtggaggacggcagctttgcgaaggcggctggcgtgatg
cacgtgaccaaggcccgagcgctgctgttccagcagcgcgacgattccacatggacagtg
ctggacggggaggcagtgcgggaggcgccgctgtacctggaggtgcatccgcggctgtgt
cggctgctggtttcgcccgtgtttagggaggagcccctttag

DBGET integrated database retrieval system