KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_89326Help
Entry
VOLCADRAFT_89326  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K20416  
palmitoyl-[glycerolipid] 7-desaturase [EC:1.14.19.42]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.42  palmitoyl-[glycerolipid] 7-desaturase
     VOLCADRAFT_89326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 438 aa AA seqDB search
MLNSCKLQSRNGSKPIVKQASFLTHANILLRCHRQAASRLGRCACIRAKLEQAEVATQKT
KDEVVVERVSSTGGSRKAFAKAFTAILGLKLAKPEDLDPETLLNPPFPRYQVPGSDLAVQ
KLRPYFFNRTYTDTDVGYLAFFAAMHLVAVIGGPLTFSWEALEVCLAGYVLTGMLGISVS
YHRQLSHKSFRCVKPLEYFLAYCGALAFEGDPVEWSKMHRWHHMHSDTTADRHSPRDGVW
HSHMGWLFDESLNSTRRDANGNMKDSLSPPWFYKESPEFYSWLRATYMYHQIGQAAFFFA
LGGVPYLVWGFVIRVLLTMHMTWLVNSAVHIWGEQRYVSNDNSRNNWIVGLLVFGDGGFG
VKLRIICQCRQHIPRHHNNHHAFEYSAAHGLEWWEIDMSYYFIRGLELLGLAWDVRRPSP
SQLVAKRIPPSPSAGASR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacagctgtaagttgcagtccaggaacggctccaagcctatagttaaacaagcg
agctttttaactcatgcaaacatactgttgagatgtcatagacaagctgcttctcggctc
ggtcgctgtgcatgcatacgagcgaagctcgagcaagcagaagtcgcgacccagaaaact
aaagatgaagtagttgtggagcgcgtaagcagcactgggggcagtcggaaggcgtttgcc
aaggctttcacggcaatattgggcctcaaactcgcaaaaccagaggacttggacccggaa
acgctgctgaacccgccgttcccgcggtaccaagtcccgggctccgacttggcggtgcag
aagctaaggccgtacttcttcaaccgcacgtacaccgatacagacgttggctacctcgct
tttttcgcagccatgcaccttgtcgcagtcatcggtggaccgttgaccttcagttgggag
gccctggaggtttgcttggcgggctatgtgttgacgggcatgttgggcatctccgtcagc
taccatcggcagctgtcccacaagtccttccgctgtgtgaagccgctggagtacttcttg
gcctattgcggagctctggcctttgagggcgaccccgtggaatggagcaagatgcatcgc
tggcaccacatgcactcggacaccaccgcggaccgccactcaccccgggacggtgtttgg
cactcccatatgggttggctcttcgatgaaagcctcaacagcaccaggcgtgatgccaat
ggcaatatgaaggacagtctgtcacccccctggttttacaaggagtctcctgagttctac
agctggttgagggccacctacatgtaccaccagatcggccaggcggcattcttcttcgca
cttggcggcgtgccgtacttggtgtggggcttcgtcatccgggtgttgctcaccatgcac
atgacctggctggtgaacagcgccgtgcacatctggggcgagcagcggtacgtgtccaat
gacaactcccggaacaactggattgtgggcctgctggtcttcggcgacgggggtttcggt
gtaaaactacgcatcatctgccaatgccgtcaacacatccccaggcatcacaacaaccac
cacgccttcgagtactccgcggcgcacggtctggagtggtgggagatcgatatgtcgtac
tacttcatccgtggtctggagcttttgggccttgcgtgggatgtacggcgccctagtcct
agccagctggtcgctaagcgcattccgccctccccaagtgccggggcgtcaaggtga

DBGET integrated database retrieval system