KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_91722Help
Entry
VOLCADRAFT_91722  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VOLCADRAFT_91722
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VOLCADRAFT_91722
Exosome [BR:vcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VOLCADRAFT_91722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 504 aa AA seqDB search
MEFTECTAALDQGTQSTRVFIFDRDCAPIASHQADLPQIYPQAGWCEHDPMEIWRTVLEC
LSRAWERETTVVWSRTTGRPLHNAIVWLDNRTSELCDKLAAVHGGRDAFRAVTGLPISPY
FSATKYLWMYENVPEVRAAVDSGDAAVGTIDSWLIWQLTGGAAGGVHVTDVTNASRTLLM
DLDSLEWHESTLEAFRCPRVVLPRIASNAEVYGLITPTHATAPQLYGSGGVPIAGCLGDQ
MAAMLGQRCRPGEAKNTYGTGCFMLLNTGQRRIASTHGLLTTVAFKLGPDKPTNYALEGS
VAVAGLGISWLRDNLGVIGSAAESEVLAASVPDTGGVYFVPAFSGLLAPHWRADARGVLL
GMTSFTTRAHVVRAMLEAICFQTREVLDAMRRDAELDEHHGGLAALRVDGGAAANDLLMQ
LQADLLQVPVVRPAFRETTSLGAALAAGLAVNMWSKEEATAFQPGVTPAAAGRRYDRWRK
AVERALDLADLAPELGEDEQPLVK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggagtttacagaatgcacagcagccttggaccagggaacacaatcgacgagggttttt
atttttgaccgagactgcgcaccgatcgcttcgcatcaagcggacctgccgcaaatatac
ccgcaagcaggttggtgcgagcatgaccctatggaaatctggcgcacggttctggagtgc
ctcagccgcgcctgggagcgcgagacgacagtggtgtggagccgaaccacgggtcggccg
ctgcacaatgccattgtgtggctggacaaccgaaccagtgagctgtgcgacaaactcgcc
gccgtacatggcggccgcgacgcgttccgtgcggtcaccggactgcccatctcgccgtac
ttttcggccaccaagtacctgtggatgtacgaaaatgtgccggaggttcgtgcagcggtg
gacagtggcgatgccgcagtgggcaccattgacagctggttgatctggcagctgactgga
ggggccgcggggggggtgcatgtcacagacgtcaccaacgcctcccgtacactcctcatg
gatctggattccttggaatggcatgaatccaccctggaagccttccgctgcccccgtgtc
gtactgccgcgaatcgcctcaaacgctgaggtgtacggcctcatcacacccacacacgcc
acggcaccccagctttacggaagcgggggggttcccattgccgggtgtctgggggaccag
atggcggccatgttaggtcagcgctgccggcccggggaggccaagaacacgtacggcacc
ggttgcttcatgttgctgaacacgggtcaacgccgtatagcctccactcacggactgctc
accaccgtggctttcaaactgggtccggacaagccgacgaactatgcgctggagggctcc
gtggctgtggccggtctgggtatcagctggttgcgggacaacctgggcgtcattggcagt
gcggcggagtccgaggtgctggcagcgtcagtcccggatacgggtggtgtgtatttcgtc
cccgccttctccgggttgctggccccccactggcgagctgatgcccggggtgtgctgctg
gggatgacctcgttcaccacccgagcacatgtggttcgcgccatgctggaggccatctgt
ttccaaacccgggaggttttggacgccatgaggcgcgatgccgagctggacgagcaccac
ggtgggttggcggcgctgcgggtggacggaggtgcggcggctaacgacctgctgatgcag
ctgcaggcggacctgctgcaggtaccagtggtacgacccgcctttagagagaccactagt
ctgggagccgccctcgctgccggactggccgtcaacatgtggtcgaaggaggaggcgaca
gcgttccagccgggtgtgacgccggcggcagcgggacgtcggtacgacaggtggcggaag
gcggttgagcgggcgctagatctggcggatctggctccggaacttggcgaggatgagcag
ccgctggtgaagtaa

DBGET integrated database retrieval system