KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_93192Help
Entry
VOLCADRAFT_93192  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     VOLCADRAFT_93192
Chromosome and associated proteins [BR:vcn03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    VOLCADRAFT_93192
   HAT complexes
    HATB complex
     VOLCADRAFT_93192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hat1_N Acetyltransf_1 MOZ_SAS Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 9628754
NCBI-ProteinID: XP_002952572
JGI: 93192
UniProt: D8U1J0
Position
Unknown
AA seq 728 aa AA seqDB search
MEPEQGQPQPKRVRLSDAQLQPQGASIIGIQGALTAGPSSTTGTTVALKPSSGGLSQLTT
ATKPAGSIASSAAPAGQTSSVGPAVPLAAPTVGPLTAEIAAGGHRVTVEFLHQHFGDSEQ
IRGYSGLNITIWIHVRTYHTWVDIQFAAKRPGADKLGPIFDGAFPSGYCRSKIYGDRLVA
TACIVAEEFVAAATAGAAAMPDLMTLGDHVGTVLLPPNAYGITARPAAGTAGSDAAADTP
GISISQNRGSAQGPMEVSVRRFQVSKAPAEVKALHARLEPLLLFTIDGAQFIDDEDPQWE
MLLPVMRAEDGGCLVLGLTTLFNFFSYPASCRLRVSQVLVLSPWQGLGLGKALLKLSYDL
AKSRRCADLTVEDPTPNLQRVREKLEVEMMRALPWVVNQARKCLDAVVRGETSWPVWEEE
EEQKMAEEEQAAETAQQLQQIAAAGATEATPPAQGAGQGVGELVVAQQPLLAAHAFFAAL
GAVPPQHMVLPEDVQVKARAEAEARWRQRLAATEDAAVKAVATEAVVGPGPSGCSEDTTV
VAGRGSSTGDMTGRGGVSSVAGALNPSPTFVSAISRELKMHRGQIRNVWEALLWCEPGAL
TRHGVRAAVEQLITSRLEAQYFSSVGRAAAAKRLVDTNRTTLQAAGSADADVDDAVREPD
FFLYRPVGQEAVARAGSGDTGAVATGRLNLTQVTADDKARRMEEMLLERRQQLEALALVL
DRDSKKQL
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggagcaagggcaaccccagcccaagcgcgttcggctttctgacgcgcagctg
caaccgcaaggcgcatccatcatcggcatccagggcgctctcacggccgggccctcgagc
acaactggtacaactgttgccctcaaaccttcgtccgggggcctttcccagctcaccacc
gccacgaagcccgcaggctccatcgcttcctctgctgcacctgcgggacaaacctccagc
gtcgggccggccgttcccctggctgccccgactgtggggcctctcacggctgaaattgcg
gcaggtggtcaccgggtgaccgtagagtttctgcaccagcactttggtgactcggagcag
atccgcggctacagcggcttgaatatcacgatctggatccatgtacgaacgtatcatacg
tgggtggacatccagtttgctgccaagcgccccggcgccgacaagcttggccccatcttt
gacggcgccttcccctctggatactgccggagcaagatatacggggatcgcctcgtcgct
accgcttgtatcgtcgcggaggagtttgtggcagcggcgacagcgggggcagccgccatg
ccggatctcatgaccctgggcgaccatgtcggcacagtgctgttgccgcccaatgcgtac
ggcattacagcacgaccggcggcagggacggctggctccgatgcagcagcagacaccccc
ggtatcagtatcagtcaaaaccgtggcagtgcgcagggccctatggaggtgtctgtacgg
cggttccaggtcagcaaagcgccggcggaggttaaggctcttcacgcccgtttggagccc
ctgttgctgttcaccattgacggagcccagttcatcgacgacgaggacccgcagtgggag
atgctgctgccggtgatgagagctgaggacgggggctgtctggtgttgggtctgactacc
ctgttcaacttcttctcctacccagcctcgtgtcgacttcgcgtgagccaggtgttggtc
ctgagtccatggcagggattaggcctgggtaaggccctccttaagctgtcgtacgatttg
gccaagtcacgccggtgcgccgatctgacggttgaggaccccaccccgaacctacaacga
gtacgtgagaagctggaggtggagatgatgagggcactgccctgggtagtgaaccaggcc
agaaagtgtctagatgcggtggttcgaggtgagaccagctggcccgtctgggaggaggag
gaggagcagaagatggctgaagaggagcaagcagcggaaacagcacagcagctgcagcag
atagcggcggctggggcgacagaagctacacccccagcccaaggcgcgggacagggcgtg
ggcgagttggttgtagcacagcaacccctcctggcagcccacgccttctttgcggccctg
ggtgcggtgcccccccagcacatggtcctgccagaggacgtgcaggtaaaggcgagggcg
gaggcggaggcgcgctggcggcagcggctggcggcaacggaggacgcggcggtgaaggca
gtcgcgacggaggcggtcgtggggccggggccgtcagggtgttctgaggacaccaccgtc
gtcgctggcagaggcagtagcactggtgacatgactggaagggggggggtttcctccgtc
gcgggtgccctgaaccctagcccgacctttgtgtctgccatcagccgcgagctgaagatg
caccgcggacagatccgaaacgtgtgggaggcgctgctctggtgtgagccgggggccctc
acccggcacggggtgagggccgctgtggagcaactcatcacctccagattggaggctcag
tacttctcctcagtggggcgggcggccgcggccaagagactggtggacactaaccgcacc
acgctgcaagctgcaggcagtgctgatgcagacgtggacgatgcggtgcgggaacccgac
tttttcctgtatagaccagtgggccaggaggcggttgcccgggcgggcagcggcgacacg
ggagctgtcgccaccggccggctcaacttgacgcaggtcaccgcggacgataaggcccgg
cgcatggaggaaatgcttctggagcggcggcagcagctcgaggcgctggcgttggtgctc
gacagggactccaagaagcagctgtag

DBGET integrated database retrieval system