KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_98607Help
Entry
VOLCADRAFT_98607  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:vcn04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 532 aa AA seqDB search
MADQVSLLGAPAVVDAVAAGFNNPTNVQGYNQGAEFYLSNYRLGKTLGIGSFGKVKVAEH
VLTGHKVAIKILNRRKIQQMEMEEKVRREIKILRLFMHPHIIRLYEVIETPSDIYVVMEY
VKTGELFDYIVEKGRLAEDEARHFFQQIISGVEYCHRNMVVHRDLKPENLLLDAKMNVKI
ADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGSLPFD
DENIPNLFKKIKGGIYNLPSHLSPGARDLIPRMLLVDPLKRITIPEIRQHPWFNMHLPRY
LAVMQVGVRTVGVRRWGRKMPSSGYLSADMAEGSTGAAMAAAGIHMPQGGTFGGPTAAVG
GGSAAAAAAGGGGGGGGAGGGAPQQRLVAERRWRLGVHARGHPSALMAELYRVLQLNQVA
WKKVAPYALKCRALVRKPPACQSTHGSSGGAAGVGRMSEDLDDHIELDGEEEDRRGGVAG
GGGESDNFFVLRFECQMYKVRDDEYVIDIQRMGGELFLFMDVCGRILCDLRM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcaggtgtctttattaggtgcacctgcagttgtggacgcggtcgctgccggg
ttcaacaacccgaccaatgtgcaaggctacaaccaaggcgcggagttctacctgagcaac
tatcgcctgggcaagacgctaggcatcgggtctttcggaaaggtgaaagtggcggagcat
gtcttgaccgggcacaaagtcgccataaagattttgaacaggaggaagatccagcaaatg
gaaatggaggagaaagtacggcgcgagatcaagattttgcgtctttttatgcatccgcac
attattcggctgtacgaggttatcgagacgccgtccgacatttacgtcgtaatggaatac
gtgaagactggcgaactgttcgactacatcgtcgagaagggccgcctggcggaagacgag
gcacgacacttctttcaacaaattatttccggggtcgagtactgccaccgcaacatggtc
gtacatcgagatcttaaacccgagaacctgctattggatgccaagatgaacgtcaagatt
gccgactttggcctttccaacatcatgcgggacggccactttctgaagaccagctgcggc
agccccaactacgcggcaccggaggtgatcagcggcaagctgtacgcgggtccggaagtg
gacgtttggagctgcggtgtcatcctgtatgcgcttctgtgcggctcactgcccttcgac
gatgaaaacattcccaacctgttcaagaagatcaagggtggcatctacaacctgccatcg
cacctgtcgcctggtgcccgtgatttgatccctcgcatgctgctggtcgacccgctgaag
cggatcaccattccggagatccggcagcacccctggttcaacatgcacctgcccagatat
ctggcggtcatgcaggtgggggtgaggacggtgggggtgaggcggtggggacgcaagatg
cccagcagcggctatctgtccgccgacatggcggagggcagtacgggggcggccatggcg
gcggcgggaatacacatgccgcaaggcggcaccttcggcggcccaacggcagcagtcgga
ggaggcagtgcagccgcagccgctgcaggtggcggcgggggcggcggcggggccggcggc
ggtgccccccagcagcggctagtggctgagcggcggtggcggctgggggttcatgcccgg
ggccacccctcggccctgatggcggagctgtaccgggtgctgcagctgaaccaggtggcc
tggaagaaggtggcgccgtacgcgctcaaatgtcgtgcactggtgcgcaagccccccgcc
tgtcaatcgacccatgggtcatcggggggtgcggcgggtgtggggcgcatgagtgaggac
ctggacgaccacatcgagctggatggtgaggaggaggacagaagggggggggtagcgggg
ggggggggggagtcggataactttttcgtcctgcgcttcgagtgccagatgtacaaagta
cgggatgacgagtacgtcattgacattcagcgcatgggcggggagctgttcctctttatg
gatgtgtgtggccgaatactttgcgatttgcgaatgtag

DBGET integrated database retrieval system