KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_99672Help
Entry
VOLCADRAFT_99672  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VOLCADRAFT_99672
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     VOLCADRAFT_99672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 854 aa AA seqDB search
MPLSTVPNGSSGAYGNIRAKRPLHTGKALPAKAQRLETPTATQAPCIGAASGVPAITEVF
AVLYTKKELLSKKKASKKFADGIITVFGDGSAILYDQDSKIVTKGRFKRFGSLENGDQVL
EIGNWHAEVDKELTSEDFRRWDGGRGRLRDGRPVVPVVIDPYLGRHLRPHQQEGVRFMYE
AVMGLTSPDRTGCILADEMGLGKTLQVITLAWTLLRQGPEGRPLAAKVLVVAPATLVDNW
GREVKKWLGSERLQLCLYLPCLSLHCYGTVTGQTYLQTLCLQQASAAKQHYETLRKHAGD
LKGAFDLLVCDEGHRLKSVGGNKTIDALLSLDCPRRILLTGTPVQNDLKEFYALLSFVVP
DVLGTPAVFNRVYGIPITRSQEATATAEEKELGAGRASELQSKVAVFILRRTQALLAKHL
PPLTSLTLFCKPSDQQIGLYSAVLRSKAVASLLYGGGGGEDNTLAVITALRKVANHPDLL
LDPSGDAGEATAEGANTGRTCSSSCLPSFSKQFTATGSHQAAGKMQVLSLLLSAIAARGE
RCVVVSTSTATLDLVGQLVCKAQGLTTVRIDGGTSVEGRQTVVDNFNKLGMGQVFLLSTR
AGGAGLNLVGACHLVLYDSDWNPAMDQQAMARIWRDGQTKPCFVYRLLTTGTIEEKVYQR
QLMKADLASATVTGGSGAAGGSKGGGKFTREELRQLFSLNTATASDTRDLLPQGKVAGLR
WKEPEEVMEDGSPLAAVAASGLVTCLNQMEPTAVSEMARDGAAAGGSPAGHHPLEEGDAP
PAHGGISVGNDSADGDAGERDESAGVAAGDDLGSKGDDIRSPSRVDAAGDGVVEGARSGT
QRDDAGCLDVLEDW
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgccactttcaactgttccgaacggcagcagcggtgcatatggcaacatccgcgcaaag
cgacccctccatacggggaaggccctgcccgcgaaagcgcagcggttagagacgccaaca
gcaactcaggcaccatgcatcggagctgcttcgggggttcctgcaatcacggaagttttt
gcggtactgtacacaaagaaggaactgctcagcaagaaaaaggcaagcaaaaagtttgcg
gatggcatcatcacagttttcggcgacggcagcgccattctgtacgaccaggatagcaaa
atagtcaccaagggccgtttcaagcgctttggcagcctggaaaacggcgaccaggtgctc
gagattggcaactggcatgcggaggtagacaaggagctgacgtccgaggatttcaggcgg
tgggatggcggccggggtcggctgcgtgacggacggcctgtggtgccagtggtcatcgat
ccctaccttggccgccacctgcggccccatcagcaggagggcgtgcggttcatgtacgag
gcggtcatgggcctgaccagtcccgacaggacgggctgcatcttggcggacgagatgggc
ctgggcaagacacttcaagtgataactctggcatggacgctcctgcggcaaggcccagag
ggcaggcctttggcggccaaggtgctggtcgtggcgcccgcaacgcttgtcgacaactgg
ggacgcgaggtcaaaaagtggctcggctcggagcgcctgcagttgtgcctctacctgccc
tgcctttctttgcactgctacggcaccgtcaccgggcaaacctacctacagacgctgtgc
ctgcagcaggcctcggccgccaagcagcactacgagacgctccgaaagcatgccggcgat
ttgaagggtgccttcgacctgctcgtgtgcgacgagggccacaggctgaaatctgttggc
ggcaacaagacgatcgatgcgctgctcagcctggactgccctcgccggatcctgttgact
ggcacaccggtgcaaaacgacctgaaggagttttatgcgctcctctccttcgtagtcccg
gacgtgttgggaacgcccgccgtgttcaaccgcgtgtacggcatacccatcacccggtcc
caggaggccactgcaacggccgaggagaaggagctgggtgcgggaagggccagtgagctg
caatcaaaggtggcagtcttcatcctccgccgtacacaggcgctgctggcaaagcacctg
ccgcccctcacatcgctcacgcttttctgcaagcccagcgaccagcaaatcggcctgtat
agcgccgtactgcgatccaaggctgtagcatcgctgctttacggcggcggtgggggagag
gacaacacgcttgccgtgatcaccgcgctgcggaaggtggccaatcacccggacctgctg
ctggaccccagcggagatgctggggaggcgacggcggagggcgcaaacacgggtcgcacg
tgctcctccagttgccttccaagcttcagcaagcagttcacagcaaccgggtcgcatcaa
gccgctgggaaaatgcaggtgctgtcactgctgctatctgcgattgcggcgcgaggtgag
cggtgtgtggtggtgtccaccagcaccgccactctggacctggtgggccagctggtgtgc
aaggcgcaagggctgacgaccgttcgcatcgacggcggcacgagtgtcgagggccgccag
accgttgtagataacttcaacaagctgggaatggggcaggtatttctgttgtccacacgg
gccggaggcgccgggctcaacctggtgggcgcctgccacttggtgctgtacgacagtgat
tggaatcccgcgatggaccagcaggcgatggcacgcatttggcgtgacggtcagaccaaa
ccctgcttcgtgtatcgcctcctcacgactggaaccattgaggagaaggtgtatcagcgc
cagctcatgaaggcggacctggccagcgccactgtgactgggggttccggagcggcgggc
ggcagcaaggggggtggcaaatttacccgtgaggagctgcgtcagctgttcagcctcaac
accgccaccgcgtccgacacgcgggacctgctgccgcagggcaaggtggctggactgcgg
tggaaggagccggaggaggtcatggaggatggcagtccgcttgcggccgtggcggccagc
gggctggtgacctgtttgaaccaaatggagccgaccgccgtgtccgagatggctagggac
ggggcagcagccgggggcagcccggccgggcatcacccccttgaggaaggggacgcgccg
ccggcgcatgggggaatttctgtcggcaatgatagtgccgatggcgatgcgggagagcgc
gacgagtcggccggcgttgcggccggggatgatttgggcagcaagggtgatgacattcgg
agcccttcccgggtcgatgcggctggggatggggttgtggagggagctcggtcagggaca
caaagggatgatgcgggctgcttggacgttttggaggactggtag

DBGET integrated database retrieval system