KEGG   Vibrio cholerae O395: VC0395_0529Help
Entry
VC0395_0529       CDS       T00520                                 

Definition
(GenBank) putative glutathione S-transferase
Organism
vco  Vibrio cholerae O395
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(583728..584339)
Genome map
AA seq 203 aa AA seqDB search
MKLYETAMTPSCRRVSIFLKELGIDVERVQVDVRGGENLSDTFKSKSLNGKVPLLELDEG
TTLCESVAICRYFDLTYPNTHKLFGDSALEQAQVEMWHRVVEFQGLYAGFQAFRNLSGIY
KDREHCVYAWGEESKARVAAFLPQLEQRLAQSRFIATDRFTIVDITAYIFIGFAQKALEL
SVFEHYPHITRWFEQLSQRPAFQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatatgaaaccgcgatgacgccaagctgtcgcagagtctcgatttttcttaaa
gaattaggcattgatgttgagcgtgttcaggtggacgttcgtggtggtgaaaacttatcg
gatacctttaaaagcaaaagtctgaacggcaaagtgcctctgcttgaactggatgagggt
acaacactgtgtgaaagtgtggcgatttgtcgttatttcgaccttacctatcccaatacg
cacaagttgttcggggattcagcattagaacaagctcaagttgaaatgtggcatcgagtg
gttgagtttcaaggcttgtatgcaggatttcaggcgtttcgaaatctaagcggtatctat
aaagatcgtgaacactgcgtttacgcgtggggtgaagagagcaaagcacgcgtggcagcc
tttttgccacaacttgagcagcgattggcacagtcgcgatttattgccacagatcgtttc
accattgttgatattaccgcctacatttttattggtttcgcccaaaaagcgctcgaactt
tctgtgtttgaacactatccgcacatcactcgttggtttgagcaactctcgcaacgacca
gcctttcaataa

DBGET integrated database retrieval system