KEGG   Vibrio cholerae O395: VC0395_0529Help
Entry
VC0395_0529       CDS       T00520                                 

Definition
putative glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
vco  Vibrio cholerae O395
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VC0395_0529
Enzymes [BR:vco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VC0395_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:complement(583728..584339)
Genome map
AA seq 203 aa AA seqDB search
MKLYETAMTPSCRRVSIFLKELGIDVERVQVDVRGGENLSDTFKSKSLNGKVPLLELDEG
TTLCESVAICRYFDLTYPNTHKLFGDSALEQAQVEMWHRVVEFQGLYAGFQAFRNLSGIY
KDREHCVYAWGEESKARVAAFLPQLEQRLAQSRFIATDRFTIVDITAYIFIGFAQKALEL
SVFEHYPHITRWFEQLSQRPAFQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatatgaaaccgcgatgacgccaagctgtcgcagagtctcgatttttcttaaa
gaattaggcattgatgttgagcgtgttcaggtggacgttcgtggtggtgaaaacttatcg
gatacctttaaaagcaaaagtctgaacggcaaagtgcctctgcttgaactggatgagggt
acaacactgtgtgaaagtgtggcgatttgtcgttatttcgaccttacctatcccaatacg
cacaagttgttcggggattcagcattagaacaagctcaagttgaaatgtggcatcgagtg
gttgagtttcaaggcttgtatgcaggatttcaggcgtttcgaaatctaagcggtatctat
aaagatcgtgaacactgcgtttacgcgtggggtgaagagagcaaagcacgcgtggcagcc
tttttgccacaacttgagcagcgattggcacagtcgcgatttattgccacagatcgtttc
accattgttgatattaccgcctacatttttattggtttcgcccaaaaagcgctcgaactt
tctgtgtttgaacactatccgcacatcactcgttggtttgagcaactctcgcaacgacca
gcctttcaataa

DBGET integrated database retrieval system