KEGG   Vibrio cholerae O395: VC0395_0682Help
Entry
VC0395_0682       CDS       T00520                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vco  Vibrio cholerae O395
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VC0395_0682 (glpK)
Enzymes [BR:vco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VC0395_0682 (glpK)
Exosome [BR:vco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VC0395_0682 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(746461..747978)
Genome map
AA seq 505 aa AA seqDB search
MTEQKYVVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPQAGWVEHDPMEIYATQSST
LVEALGKAGIRSDEVAAIGITNQRETTVVWNKETGKPVYNAIVWQCRRTATICEELKARG
LESYIRDNTGLVLDPYFSGTKIKWILDNVEGAREQAEAGQLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMLFNINTLQWDEKILAEFNIPLSMMPEVKKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALYGQMCVQAGQAKNTYGTGCFLLMNTGQEKVTSHNGLLTTLACGPRGEPA
YALEGAVFMGGASIQWLRDELKLISDARDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGIKLSALRVDGGAVANNFLM
QFQADVLDTEVHRPKVTEVTALGAAYLAGLAVGFWDGLEELQGKAEIDRSFKPHHDEEKR
QRRYKGWKRAVKCAQAWAVLHNEEE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcaaaaatacgtcgtcgctctcgatcaaggtactaccagctctcgcgccgtg
gtgttagaccatgatgcgaatatcgtgagcgtttctcagcgtgagtttacccaaatctac
ccgcaagccgggtgggtggagcacgatccaatggaaatctacgctacgcaaagctcaaca
ttggttgaagcgctaggtaaagcgggcattcgcagtgatgaagttgcggctatcggtatt
accaaccaacgtgaaaccacggtagtgtggaataaagagacgggtaagcctgtctacaac
gcgattgtttggcaatgtcgccgtactgctaccatttgtgaagagctgaaagcgcgcggt
ttagaaagttacattcgcgacaataccggtttggtgctcgacccttacttctcaggtacc
aaaattaaatggattctggacaatgtagaaggcgcacgcgagcaagctgaagcaggacaa
ctgctgtttggtacggttgatacgtggctagtgtggaaaatgactcaaggccgtgtgcat
gtgaccgattacaccaacgcatcccgtactatgctgttcaacatcaacaccttgcagtgg
gatgaaaagatcctcgccgaatttaatatcccgctctccatgatgccggaagtgaaaaaa
tcgtctgaagtgtacggtcaaaccaacatcggtggtaaaggcggtacgcgtattccaatc
gcggggattgccggtgaccaacaagcggcgctgtacggccaaatgtgtgtgcaagcggga
caagcgaaaaacacctacggtacgggttgcttcttgctgatgaacacaggacaggaaaaa
gtgacctcgcacaacggcttgctgaccacgctagcgtgtggcccacgtggtgaacccgct
tatgcactggaaggtgcggtgtttatgggcggtgcatcgattcaatggctgcgtgatgaa
ctgaaactgatttccgatgctcgcgactcagaatacttcgccaccaaagtggatacttca
aatggtgtgtatgtggtgccagcctttacgggtttaggcgctccgtactgggatgcgtat
gcgcgtggcacaattgtcggcttaacccgtggtgtgaattcaaaccacattattcgcgca
acgctggaaagtatcgcttaccaaacgcgtgatgtgctggatgcgatgcaagcggattcg
ggcatcaagctttctgcactgcgtgtcgatggcggtgcggtcgccaacaacttcctgatg
cagttccaagcggatgtattggatactgaagtgcatcgtccgaaagtcacggaagtcacc
gcgttaggtgccgcttatctagccggtcttgctgttggtttctgggatggtttggaagag
ctgcaaggcaaagcggaaatcgatcgcagctttaaaccgcatcatgatgaagagaagcgt
caacgccgttataaaggttggaagcgtgcggtgaaatgtgcccaagcgtgggcagtactg
cacaacgaagaagagtaa

DBGET integrated database retrieval system