KEGG   Vibrio cholerae O395: VC0395_0724Help
Entry
VC0395_0724       CDS       T00520                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
vco  Vibrio cholerae O395
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:vco01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1:785208..785855
Genome map
AA seq 215 aa AA seqDB search
METNLDSDCAEMMDVCMTRLLSFLFVVLFSAAASSKTLLVLGDSLSAGYEMPIEQAWPSL
LAEELVEQGQTVTVVNGSISGDTTGNGLARLPSLLSQHQPDTVLIELGANDGLRGFPPQT
VTHNLTTMIEQIQAKNAKVILMQIRIPPNYGKRYSDAFYQIYPSLAEQFSIPLIPFFLEQ
VILKPEWMMADGLHPKPEAQPWIAKFVAEHLAAHL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtggagactaatttggatagtgattgcgctgaaatgatggatgtttgcatgactcgacta
ctttcctttttgtttgttgttctcttttctgctgcagccagcagtaaaacgttattggta
ctcggcgacagtttaagcgcagggtacgaaatgcctatcgaacaagcttggccaagttta
ctggccgaagagctagtggaacagggtcaaaccgttaccgtagttaacggaagcatttct
ggtgataccacaggcaacgggctcgcccgcctgccctctcttctgagccaacatcagccc
gataccgtactgatagaattaggagccaacgacggtttacgcggttttccaccgcaaacg
gtcactcataacctcaccaccatgattgaacagatccaagctaaaaacgcaaaagtcatc
ttaatgcagatccgtatcccacctaactatggcaaacggtacagcgatgcgttttaccag
atctatcctagcctagctgagcagttttctatcccgcttatcccgttctttcttgagcaa
gtgatcctcaaaccagaatggatgatggcagatggtttacaccccaaacctgaagcgcag
ccttggatagccaagtttgtggccgaacaccttgccgcacatttgtaa

DBGET integrated database retrieval system