KEGG   Vibrio cholerae O395: VC0395_1046Help
Entry
VC0395_1046       CDS       T00520                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
vco  Vibrio cholerae O395
Brite
Enzymes [BR:vco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     VC0395_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1023199..1023786)
Genome map
AA seq 195 aa AA seqDB search
MKITKKIWCSVAAVISLITGGAIVGQEYVQPVGQVVIEGQALGELRISPKGLEIIGNAEG
CRQDPYKCPAGLMTNGIGNTHGVPNHVVTLEQIAKDWVKNIKEAEQCVTDAERLSGRRLN
QGQFDGFTSFVFNFGCTKFRKNKDGTDTRIYRAIKQGRFIQGCGHIQEWVKFDGIVLPGL
VTRRGLEYARCMEVD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataactaaaaaaatttggtgctcagtcgccgccgtgatcagccttatcacgggc
ggggcgatagtcggccaagaatacgtacagccagttggtcaagtggtgatcgaaggccaa
gcccttggtgaactacgcatcagcccaaaagggctagaaattattggaaacgcagaaggt
tgccgacaagacccttataaatgtccggcaggtctaatgactaatggaattggtaacacc
catggtgtgccgaatcacgtagtgacacttgagcaaattgccaaagattgggtgaaaaac
atcaaagaggcagagcaatgtgtaacggacgctgaacgtctgtctgggcgaaggttgaat
caagggcagttcgatggttttacatcatttgttttcaattttggatgtaccaaatttcga
aaaaataaagatgggacagacacacgaatctatcgagcaattaaacaaggacgatttatt
caaggctgcggccatattcaagaatgggtgaaattcgatggaatagtcctgccggggcta
gtcactcgaagaggcttggaatatgccagatgtatggaagtggattaa

DBGET integrated database retrieval system