KEGG   Vibrio cholerae O395: VC0395_A0060Help
Entry
VC0395_A0060      CDS       T00520                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vco  Vibrio cholerae O395
Brite
Enzymes [BR:vco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     VC0395_A0060 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 RrnaAD Methyltransf_25 Methyltransf_11 DREV Methyltransf_23 GCD14 Methyltr_RsmB-F Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ABQ21782
UniProt: A5F9C1
Structure
PDB: 

Jmol
Position
2:53882..54508
Genome map
AA seq 208 aa AA seqDB search
MANPKADRLIQFLTEQGITSPQVLAAIHALPREFFVAPAMMHQAYDNNALPIGQGQTISQ
PYIVAKMTELLALTPETKVLEIGTGSGYQTAVLAKLVNHVFTVERIKTLQWDAKRRLKQL
DIYNVSTKHGDGWQGWPARGPFDAILVTAAAAKVPQSLLDQLAEGGRMVIPVGEDEQYLY
KIVRQGGQFISERVEAVRFVPLVAGDLA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccaaaagccgacagactgattcaatttttaactgagcaggggattacctca
ccacaagtgttggcggcaatccatgcactgccacgcgagtttttcgtcgcaccggccatg
atgcatcaagcttatgacaataatgccctgcccataggtcaaggccagaccatctcgcaa
ccctatatcgtggcgaagatgacagagctactggcgttaaccccagaaaccaaagtgcta
gaaattggtacgggctctggttatcaaaccgcagtgctcgccaaactggttaatcatgtg
tttactgttgagcggatcaaaaccctgcaatgggatgcgaaaagacgcttgaaacagttg
gatatctataacgtgtcgacgaaacatggcgatggctggcaaggttggcccgctcgtgga
ccttttgatgcgatccttgtgacggctgctgcggcaaaagtgccgcaaagtctattggat
cagcttgctgagggtggtcgtatggtgatccctgtgggcgaagacgagcaatatctgtac
aaaattgtgcgtcaaggtgggcagtttatctctgagcgggttgaagctgtgcgttttgtg
ccactggtcgcgggagatcttgcctga

DBGET integrated database retrieval system