KEGG   Vibrio cholerae O395: VC0395_A0124Help
Entry
VC0395_A0124      CDS       T00520                                 

Gene name
folK-2
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
vco  Vibrio cholerae O395
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vco00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:complement(111157..111660)
Genome map
AA seq 167 aa AA seqDB search
MMLAYIAIGSNLGDPVAQAQLAIQQLTLLPKSRLIAASSLYSSTPMGPQNQPDYINAVAA
IETELTPLELLDCTQRIELEQGRVRKSERWGPRTLDLDIVLYGNEVIETERLTIPHYGMK
VREFVLYPLAEIAPNLTLPDGTEIQALLQQVPLNGLSIWHSPTSSKD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttgcctacattgcgattggcagtaatttgggcgaccctgtcgcccaagcacag
ctggccatacaacagcttactctcttaccgaagtcgcgccttatcgcggcttcatcgctc
tatagcagcactccgatggggccgcaaaatcagcctgattacatcaacgctgtcgccgcc
atcgaaaccgaattaacgccactggaattgctcgattgcacacaacgcattgagctagaa
caggggcgtgtccgtaaaagcgaacgatggggaccgagaaccctcgatctcgatattgtg
ctttacggcaatgaggtgatagagaccgagcgcctcaccattcctcactatggaatgaaa
gtacgtgaattcgtgctttacccgctcgcggaaatcgcaccaaatttaaccctcccagac
gggactgaaatccaagcgttattgcaacaagtaccgctcaatgggctcagcatttggcac
tcgccaacgtcgagtaaggactaa

DBGET integrated database retrieval system