KEGG   Vibrio cholerae O395: VC0395_A0142Help
Entry
VC0395_A0142      CDS       T00520                                 

Gene name
chb-1
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
vco  Vibrio cholerae O395
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VC0395_A0142 (chb-1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VC0395_A0142 (chb-1)
Enzymes [BR:vco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VC0395_A0142 (chb-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:complement(137659..139572)
Genome map
AA seq 637 aa AA seqDB search
MSYRIEFAVLSEQKPDCRFGLTLHNLSDQDLHDWSLYFVIDRYIQPMSVTNGQLTQVGSL
CSIVPTEKVLQANGHFYCEFIIKTAPYHFYTDGVKHAFVQLNDKQPVERINVAVNPIVLA
SPFRERSQIPEVTAAELCLIPKPNSLQRFQGEFVVNHSSQISLQSDSAARAARWLEQELH
ALHEFKLNTVGHSDIVYRSNPTLDEGHYQLNIEAQGIKIEAGSHSGFMHASATLLQLAQA
HQGSLRFPLVNIVDAPRFKYRGMMLDCARHFHSLEQVKRVINQLAHYKFNVFHWHLTDDE
GWRIEIKRLPQLTDIGAWRGMDEVLEPQYSLLTERHGGFYTQEEIRAVIEYASDRGITVI
PEIDVPGHSRAAIKALPEWLVDEEDCSQYRSIQYYNDNVLSPALPGTYQFLDIVLEEVAA
LFPSQFIHIGADEVPHGVWVDSPKCQALMQEQGYTDPKELQGHLLRYAEKKLKSLGKRMV
GWEEAHHGDKVSKDTVIYSWLSEKAALDCAKQGFDVILQPGQFTYLDIVQDYAPEEPGVD
WAGVTPLERAYGYEPLADVPANNPLRKRILGIQCALWCELINHSERMEYMLYPRLTALAE
GGWTEKSQRDWLDYLARLKGHLPLLDKQKIPYRAPWK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagttatcgaattgaatttgcggtgctctcggaacaaaaaccggattgccgttttggt
ttaaccctgcacaatttgagcgatcaagatctgcatgattggtcgctgtattttgtgatt
gatcgttacatccaacccatgagtgtgaccaacggtcaactgacccaagtcggcagctta
tgttcgattgttccaacggaaaaagtgttgcaagctaatggccacttttattgtgagttc
atcatcaaaaccgcgccttaccatttctacaccgatggggtaaagcacgcgtttgtccaa
cttaatgataaacagcctgttgaacgtattaacgtcgcggttaaccctatcgttctcgcg
tcaccatttcgcgagcgtagccagatccctgaagtgactgcggctgagctctgtctcatc
cccaaacctaactcactgcaacgtttccaaggtgagtttgtggtcaaccactccagccag
atctcgctgcaatcggactcggccgcgcgtgctgcacgctggttagagcaagaattgcat
gcactgcatgagttcaaactgaatacggttggccatagcgatatcgtctaccgcagtaat
cccacgctcgatgagggccattaccaactcaatatcgaagcgcaagggatcaagattgaa
gcaggcagccacagtggctttatgcatgccagcgcgactttgctgcaactggcgcaagcg
catcaaggctcattgcgctttcctctggtcaacattgtcgatgcaccgcgctttaagtat
cgcggtatgatgctcgattgcgcccgccattttcactcgcttgagcaggtcaaacgagtg
atcaatcaactggcacactacaaatttaacgtgttccactggcatctgactgatgatgaa
ggttggcgtattgagattaaacgcctgccgcaactgacagacattggtgcatggcgtggc
atggatgaagtgctggaacctcagtacagcttactcaccgagcgtcatggcggtttctat
acccaagaggagatccgtgcagtgattgagtacgccagcgatcgtggcattactgtcatc
cctgaaattgacgtaccagggcacagccgcgccgcgattaaagcgctgccggaatggctg
gtcgatgaggaagattgctcgcaatatcgcagtattcagtactacaacgacaacgtgctc
tcccctgcactgccgggcacttatcaattcctcgacatcgtattagaagaagtggctgcg
ctgtttccaagccaatttattcatatcggtgccgatgaagttccacacggtgtgtgggta
gatagcccgaaatgccaagccttaatgcaagagcaaggctataccgacccgaaagagctg
caaggccacttactgcgctacgccgagaaaaaactcaaaagcttgggtaagcgtatggtc
ggctgggaagaagcccatcacggtgacaaagtgagtaaagatacggtgatttactcttgg
ttatcggaaaaagccgccttggattgcgccaaacaaggctttgacgtgattttgcagccg
ggacaatttacctatctcgatatcgttcaagactatgctcctgaagaaccgggcgtggat
tgggcaggtgttactccgctagagcgtgcttacggttatgaaccgttagctgacgttccg
gccaataacccactgcgtaaacgcattttaggtattcaatgcgccttgtggtgtgaattg
atcaatcactcagaacgcatggaatacatgctctatccacgtctcacggcattagctgaa
ggcggttggacagagaaatcccagcgtgactggttggattatctagcgcgtttgaaaggc
catttaccactgcttgataagcagaaaataccttatcgcgcgccttggaagtaa

DBGET integrated database retrieval system