KEGG   Vibrio cholerae O395: VC0395_A0187Help
Entry
VC0395_A0187      CDS       T00520                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vco  Vibrio cholerae O395
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VC0395_A0187 (holD)
   00240 Pyrimidine metabolism
    VC0395_A0187 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VC0395_A0187 (holD)
   03430 Mismatch repair
    VC0395_A0187 (holD)
   03440 Homologous recombination
    VC0395_A0187 (holD)
Enzymes [BR:vco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VC0395_A0187 (holD)
DNA replication proteins [BR:vco03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VC0395_A0187 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2:191562..191969
Genome map
AA seq 135 aa AA seqDB search
MLSSSHYLSAMDIQQWELIHPERLAGFQPRTQTLDHDCRLLLVANQPPQGAEILLLERIL
KSFQLELSMVRYIAPIQLSQLAYTGLEWIWFAGCDPLSHQAQKQLHSPRLSDIDGNTQYR
RALWQQICAHQGIAS
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgctttcttcttcacactatttgtccgcgatggacattcaacaatgggaattgatccat
ccagagcgtttggccggatttcagccgcgcacacaaacgctggatcacgattgccgactc
ttgttggtggccaatcaaccgccacaaggcgcggaaattctgttgctggagagaattctc
aaaagctttcagcttgagctgtcgatggttcgctacatcgcaccgattcagctcagtcaa
cttgcctatactggactcgagtggatctggtttgcgggctgcgatcccttatctcatcag
gctcaaaaacagctgcattcaccgcggttgagtgacattgatggcaatactcaataccgc
cgcgcgttgtggcagcaaatttgcgctcatcaaggaatcgcatcatga

DBGET integrated database retrieval system